PDB entry 6f4m

View 6f4m on RCSB PDB site
Description: human jmjd5 in its apo form.
Deposited on 2017-11-29, released 2018-04-04
The last revision was dated 2018-04-04, with a file datestamp of 2018-03-29.
Experiment type: XRAY
Resolution: 1.71 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: JmjC domain-containing protein 5
    Species: Homo sapiens [TaxId:9606]
    Gene: KDM8, JMJD5
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8N371 (0-234)
      • expression tag (0)
      • engineered mutation (35)
      • engineered mutation (50)
      • engineered mutation (113)
      • engineered mutation (202)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6f4mA (A:)
stvprlhrpslqhfreqflvpgrpvilkgvadhwpamqkwsleyiqeiagartvpvevgs
rytdeewsqtlmtvnefiskyivneprdvgylaqhqlfdqipelkqdisipdyaslgdge
eeeitinawfgpqgtisplhqdpqqnflvqvmgrkyirlyspqesgalyphdthllhnts
qvdvenpdlekfpkfakapflsailspgeilfipvkywhyvraldlsfsvsfwws