PDB entry 6f48

View 6f48 on RCSB PDB site
Description: Structure of quinolinate synthase with reaction intermediates X and Y
Class: transferase
Keywords: NAD BIOSYNTHESIS, IRON SULFUR CLUSTER, transferase
Deposited on 2017-11-29, released 2018-04-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-04-25, with a file datestamp of 2018-04-20.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Quinolinate synthase A
    Species: Thermotoga maritima [TaxId:2336]
    Gene: nadA, TM_1644
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X1X7 (7-304)
      • expression tag (3-6)
      • engineered mutation (27)
      • engineered mutation (225)
    Domains in SCOPe 2.07: d6f48a1, d6f48a2
  • Heterogens: XQB, YQA, SF4, GOL, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6f48A (A:)
    mhhhhhhmvdeilklkkekgyiilahnfqipelqdiadfvgdslqlarkamelsekkilf
    lgvdfmaelvkilnpdkkvivpdrsatcpmanrltpeiireyrekfpdapvvlyvnstse
    cktladvictsanavevvkkldssvvifgpdrnlgeyvaektgkkvitipenghcpvhqf
    naesidavrkkypdakvivhpecpkpvrdkadyvgstgqmekiperdpsrifvigteigm
    ihklkkkfpdrefvplemavcvnmkkntlentlhalqtesfevilpkeviekakkpilrm
    felmg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6f48A (A:)
    hhhhmvdeilklkkekgyiilahnfqipelqdiadfvgdslqlarkamelsekkilflgv
    dfmaelvkilnpdkkvivpdrsatcpmanrltpeiireyrekfpdapvvlyvnstseckt
    ladvictsanavevvkkldssvvifgpdrnlgeyvaektgkkvitipenghcpvhqfnae
    sidavrkkypdakvivhpecpkpvrdkadyvgstgqmekiperdpsrifvigteigmihk
    lkkkfpdrefvplemavcvnmkkntlentlhalqtesfevilpkeviekakkpilrmfel
    mg