PDB entry 6f46

View 6f46 on RCSB PDB site
Description: structure of the transmembrane helix of bclxl in phospholipid nanodiscs
Deposited on 2017-11-29, released 2018-07-18
The last revision was dated 2019-05-08, with a file datestamp of 2019-05-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bcl-2-like protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: BCL2L1, BCL2L, BCLX
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6f46A (A:)
gsgesrkgqerfnrwfltgmtvagvvllgslfsrk

    Sequence, based on observed residues (ATOM records):
    >6f46A (A:)
esrkgqerfnrwfltgmtvagvvllgslfsrk