PDB entry 6f3z

View 6f3z on RCSB PDB site
Description: Complex of E. coli LolA and periplasmic domain of LolC
Class: protein transport
Keywords: Lipoprotein trafficking, PROTEIN TRANSPORT
Deposited on 2017-11-29, released 2018-07-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-07-25, with a file datestamp of 2018-07-20.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lipoprotein-releasing system transmembrane protein LolC
    Species: Escherichia coli K-12 [TaxId:83333]
    Gene: lolC, ycfU, b1116, JW5161
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ADC3 (0-218)
      • expression tag (219-229)
  • Chain 'B':
    Compound: Outer-membrane lipoprotein carrier protein
    Species: Escherichia coli K-12 [TaxId:83333]
    Gene: lolA, lplA, yzzV, b0891, JW0874
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61316 (24-205)
      • expression tag (18-23)
    Domains in SCOPe 2.07: d6f3zb1, d6f3zb2
  • Chain 'C':
    Compound: Lipoprotein-releasing system transmembrane protein LolC
    Species: Escherichia coli K-12 [TaxId:83333]
    Gene: lolC, ycfU, b1116, JW5161
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ADC3 (0-218)
      • expression tag (219-224)
  • Chain 'D':
    Compound: Outer-membrane lipoprotein carrier protein
    Species: Escherichia coli K-12 [TaxId:83333]
    Gene: lolA, lplA, yzzV, b0891, JW0874
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61316 (24-205)
      • expression tag (18-23)
    Domains in SCOPe 2.07: d6f3zd1, d6f3zd2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6f3zB (B:)
    mgsshhhhhhssglvprgshmasmdaasdlksrldkvssfhasftqkvtdgsgaavqegq
    gdlwvkrpnlfnwhmtqpdesilvsdgktlwfynpfveqatatwlkdatgntpfmliarn
    qssdwqqynikqngddfvltpkasngnlkqftinvgrdgtihqfsaveqddqrssyqlks
    qqngavdaakftftppqgvtvddqrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6f3zB (B:)
    shmasmdaasdlksrldkvssfhasftqkvtdgsgaavqegqgdlwvkrpnlfnwhmtqp
    desilvsdgktlwfynpfveqatatwlkdatgntpfmliarnqssdwqqynikqngddfv
    ltpkasngnlkqftinvgrdgtihqfsaveqddqrssyqlksqqngavdaakftftppqg
    vtvddqrk
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6f3zD (D:)
    mgsshhhhhhssglvprgshmasmdaasdlksrldkvssfhasftqkvtdgsgaavqegq
    gdlwvkrpnlfnwhmtqpdesilvsdgktlwfynpfveqatatwlkdatgntpfmliarn
    qssdwqqynikqngddfvltpkasngnlkqftinvgrdgtihqfsaveqddqrssyqlks
    qqngavdaakftftppqgvtvddqrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6f3zD (D:)
    shmasmdaasdlksrldkvssfhasftqkvtdgsgaavqegqgdlwvkrpnlfnwhmtqp
    desilvsdgktlwfynpfveqatatwlkdatgntpfmliarnqssdwqqynikqngddfv
    ltpkasngnlkqftinvgrdgtihqfsaveqddqrssyqlksqqngavdaakftftppqg
    vtvddqrk