PDB entry 6f3k

View 6f3k on RCSB PDB site
Description: combined solid-state nmr, solution-state nmr and em data for structure determination of the tetrahedral aminopeptidase tet2 from p. horikoshii
Deposited on 2017-11-28, released 2018-03-14
The last revision was dated 2019-08-28, with a file datestamp of 2019-08-23.
Experiment type: EM;NMR;SOLID-STATENMR
Resolution: 4.1 Å
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tetrahedral aminopeptidase
    Species: Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) [TaxId:70601]
    Gene: frvX, PH1527
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ZN

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6f3kA (A:)
mevrnmvdyellkkvveapgvsgyeflgirdvvieeikdyvdevkvdklgnviahkkgeg
pkvmiaahmdqiglmvthiekngflrvapiggvdpktliaqrfkvwidkgkfiygvgasv
pphiqkpedrkkapdwdqifidigaeskeeaedmgvkigtvitwdgrlerlgkhrfvsia
fddriavytilevakqlkdakadvyfvatvqeevglrgartsafgiepdygfaidvtiaa
dipgtpehkqvthlgkgtaikimdrsvichptivrwleelakkheipyqleillgggtda
gaihltkagvptgalsvparyihsntevvderdvdatvelmtkalenihelki