PDB entry 6f3e

View 6f3e on RCSB PDB site
Description: IRAK4 IN COMPLEX WITH inhibitor
Class: signaling protein
Keywords: IRAK4, kinase, inhibitor, cancer, SIGNALING PROTEIN
Deposited on 2017-11-28, released 2018-05-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-23, with a file datestamp of 2018-05-18.
Experiment type: XRAY
Resolution: 2.67 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: interleukin-1 receptor-associated kinase 4
    Species: Homo sapiens [TaxId:9606]
    Gene: Irak4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6f3ea_
  • Chain 'B':
    Compound: interleukin-1 receptor-associated kinase 4
    Species: Homo sapiens [TaxId:9606]
    Gene: Irak4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6f3eb_
  • Heterogens: SO4, CJQ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6f3eA (A:)
    rfhsfsfyelknvtnnfderpisvggnkmgeggfgvvykgyvnnttvavkklaamvditt
    eelkqqfdqeikvmakcqhenlvellgfssdgddlclvyvympngslldrlscldgtppl
    swhmrckiaqgaanginflhenhhihrdiksanilldeaftakisdfglarasekfaqtv
    mtsrivgttaymapealrgeitpksdiysfgvvlleiitglpavdehrepqllldikeei
    edeektiedyidkkmndadstsveamysvasqclhekknkrpdikkvqqllqemt
    

    Sequence, based on observed residues (ATOM records): (download)
    >6f3eA (A:)
    rfhsfsfyelknvtnnfderpisvggnkmgeggfgvvykgyvnnttvavkkllkqqfdqe
    ikvmakcqhenlvellgfslclvyvympngslldrlscldgtpplswhmrckiaqgaang
    inflhenhhihrdiksanilldeaftakisdfglatvmtsrivgttaymapealrgeitp
    ksdiysfgvvlleiitglpavdehrepqllldikeeiedeektiedyidkkmndadstsv
    eamysvasqclhekknkrpdikkvqqllqemt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6f3eB (B:)
    rfhsfsfyelknvtnnfderpisvggnkmgeggfgvvykgyvnnttvavkklaamvditt
    eelkqqfdqeikvmakcqhenlvellgfssdgddlclvyvympngslldrlscldgtppl
    swhmrckiaqgaanginflhenhhihrdiksanilldeaftakisdfglarasekfaqtv
    mtsrivgttaymapealrgeitpksdiysfgvvlleiitglpavdehrepqllldikeei
    edeektiedyidkkmndadstsveamysvasqclhekknkrpdikkvqqllqemt
    

    Sequence, based on observed residues (ATOM records): (download)
    >6f3eB (B:)
    rfhsfsfyelknvtnnfderpisvggnkmgeggfgvvykgyvnnttvavkkltteelkqq
    fdqeikvmakcqhenlvellgfssdgddlclvyvympngslldrlscldgtpplswhmrc
    kiaqgaanginflhenhhihrdiksanilldeaftakisdfglarastvmtsrivgttay
    mapealrgeitpksdiysfgvvlleiitglpavdehrepqllldikeeiedeektiedyi
    dkkmndadstsveamysvasqclhekknkrpdikkvqqllqemt