PDB entry 6f35

View 6f35 on RCSB PDB site
Description: Crystal structure of the aspartate aminotranferase from Rhizobium meliloti
Class: transferase
Keywords: Aspartate Amino-transferase, TRANSFERASE
Deposited on 2017-11-28, released 2019-03-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-03-13, with a file datestamp of 2019-03-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aspartate aminotransferase B
    Species: Rhizobium meliloti (strain 1021) [TaxId:266834]
    Gene: aatB, R03291, SMc04386
    Database cross-references and differences (RAF-indexed):
    • Uniprot P58350 (Start-409)
      • conflict (291)
    Domains in SCOPe 2.07: d6f35a_
  • Chain 'B':
    Compound: Aspartate aminotransferase B
    Species: Rhizobium meliloti (strain 1021) [TaxId:266834]
    Gene: aatB, R03291, SMc04386
    Database cross-references and differences (RAF-indexed):
    • Uniprot P58350 (Start-409)
      • conflict (291)
    Domains in SCOPe 2.07: d6f35b_
  • Heterogens: PLP, ACT, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6f35A (A:)
    mtinatvkeagfqpasrissigvseilkigaraaamkregkpviilgagepdfdtpehvk
    qaasdaihrgetkytaldgtpelkkairekfqrenglayeldeitvatgakqilfnamma
    sldpgdeviiptpywtsysdivhicegkpvliacdassgfrltaekleaaitprtrwvll
    nspsnpsgaaysaadyrpllevllrhphvwllvddmyehivydgfrfvtpaqlepglknr
    tltvngvskayamtgwrigyaggprelikamavvqsqatscpssisqaasvvalngpqdf
    lkertesfqrrrdlvvnglnaidgldcrvpegafytfsgcagvlgkvtpsgkriktdtdf
    caylledahvavvpgsafglspffrisyatseaelkealeriaaacdrls
    

    Sequence, based on observed residues (ATOM records): (download)
    >6f35A (A:)
    gfqpasrissigvseilkigaraaamkregkpviilgagepdfdtpehvkqaasdaihrg
    etkytaldgtpelkkairekfqrenglayeldeitvatgakqilfnammasldpgdevii
    ptpywtsysdivhicegkpvliacdassgfrltaekleaaitprtrwvllnspsnpsgaa
    ysaadyrpllevllrhphvwllvddmyehivydgfrfvtpaqlepglknrtltvngvska
    yamtgwrigyaggprelikamavvqsqatscpssisqaasvvalngpqdflkertesfqr
    rrdlvvnglnaidgldcrvpegafytfsgcagvlgkvtpsgkriktdtdfcaylledahv
    avvpgsafglspffrisyatseaelkealeriaaacdrls
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6f35B (B:)
    mtinatvkeagfqpasrissigvseilkigaraaamkregkpviilgagepdfdtpehvk
    qaasdaihrgetkytaldgtpelkkairekfqrenglayeldeitvatgakqilfnamma
    sldpgdeviiptpywtsysdivhicegkpvliacdassgfrltaekleaaitprtrwvll
    nspsnpsgaaysaadyrpllevllrhphvwllvddmyehivydgfrfvtpaqlepglknr
    tltvngvskayamtgwrigyaggprelikamavvqsqatscpssisqaasvvalngpqdf
    lkertesfqrrrdlvvnglnaidgldcrvpegafytfsgcagvlgkvtpsgkriktdtdf
    caylledahvavvpgsafglspffrisyatseaelkealeriaaacdrls
    

    Sequence, based on observed residues (ATOM records): (download)
    >6f35B (B:)
    gfqpasrissigvseilkigaraaamkregkpviilgagepdfdtpehvkqaasdaihrg
    etkytaldgtpelkkairekfqrenglayeldeitvatgakqilfnammasldpgdevii
    ptpywtsysdivhicegkpvliacdassgfrltaekleaaitprtrwvllnspsnpsgaa
    ysaadyrpllevllrhphvwllvddmyehivydgfrfvtpaqlepglknrtltvngvska
    yamtgwrigyaggprelikamavvqsqatscpssisqaasvvalngpqdflkertesfqr
    rrdlvvnglnaidgldcrvpegafytfsgcagvlgkvtpsgkriktdtdfcaylledahv
    avvpgsafglspffrisyatseaelkealeriaaacdrls