PDB entry 6f2x

View 6f2x on RCSB PDB site
Description: Structural characterization of the Mycobacterium tuberculosis Protein Tyrosine Kinase A (PtkA)
Class: transferase
Keywords: tyrosine kinase phosphorylation Mycobacterium tuberculosis, TRANSFERASE
Deposited on 2017-11-27, released 2018-07-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-09-11, with a file datestamp of 2019-09-06.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein Tyrosine Kinase A
    Species: Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) [TaxId:83332]
    Gene: Rv2232, MTCY427.13/MTCY427.14
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6f2xa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6f2xA (A:)
gespqlvifdldgtltdsargivssfrhalnhigapvpegdlathivgppmhetlramgl
gesaeeaivayradysargwamnslfdgigplladlrtagvrlavatskaeptarrilrh
fgieqhfeviagastdgsrgskvdvlahalaqlrplperlvmvgdrshdvdgaaahgidt
vvvgwgygradfidktsttvvthaatidelrealgv