PDB entry 6f2l

View 6f2l on RCSB PDB site
Description: Crystal structure of the complex between PPARgamma LBD and the ligand LJ570: structure obtained from crystals of the apo-form soaked for 15 days.
Class: transcription
Keywords: nuclear receptor, transcription factor, complex with an agonist, TRANSCRIPTION
Deposited on 2017-11-24, released 2018-01-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-01-10, with a file datestamp of 2018-01-05.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peroxisome proliferator-activated receptor gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: PPARG, NR1C3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6f2la_
  • Chain 'B':
    Compound: Peroxisome proliferator-activated receptor gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: PPARG, NR1C3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6f2lb_
  • Heterogens: AXY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6f2lA (A:)
    mgsshhhhhhssglvprgshmaeissdidqlnpesadlralakhlydsyiksfpltkaka
    railtgkttdkspfviydmnslmmgedkikfkhitplqeqskevairifqgcqfrsveav
    qeiteyaksipgfvnldlndqvtllkygvheiiytmlaslmnkdgvlisegqgfmtrefl
    kslrkpfgdfmepkfefavkfnalelddsdlaifiaviilsgdrpgllnvkpiediqdnl
    lqalelqlklnhpessqlfakllqkmtdlrqivtehvqllqvikktetdmslhpllqeiy
    kdly
    

    Sequence, based on observed residues (ATOM records): (download)
    >6f2lA (A:)
    esadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkikfkk
    evairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheiiytmlaslmn
    kdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlaifiaviilsg
    drpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqivtehvqllqv
    ikktetdmslhpllqeiyk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6f2lB (B:)
    mgsshhhhhhssglvprgshmaeissdidqlnpesadlralakhlydsyiksfpltkaka
    railtgkttdkspfviydmnslmmgedkikfkhitplqeqskevairifqgcqfrsveav
    qeiteyaksipgfvnldlndqvtllkygvheiiytmlaslmnkdgvlisegqgfmtrefl
    kslrkpfgdfmepkfefavkfnalelddsdlaifiaviilsgdrpgllnvkpiediqdnl
    lqalelqlklnhpessqlfakllqkmtdlrqivtehvqllqvikktetdmslhpllqeiy
    kdly
    

    Sequence, based on observed residues (ATOM records): (download)
    >6f2lB (B:)
    esadlralakhlydsyiksfpltkakarailtkttdkspfviydmnslmmgedkikfkhi
    tkevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheiiytmlasl
    mnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlaifiaviil
    sgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqivtehvqll
    qvikktehpllqeiy