PDB entry 6f24

View 6f24 on RCSB PDB site
Description: ph domain from pfaph
Deposited on 2017-11-23, released 2018-12-12
The last revision was dated 2018-12-12, with a file datestamp of 2018-12-07.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: C-terminal PH domain from PfAPH
    Species: Plasmodium falciparum Tanzania (2000708) [TaxId:1036725]
    Gene: PFTANZ_00863
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6f24A (A:)
sakdikdekiqqyrktltkivkiktaifhetvkvtcskdgkmlewykgkndsdgkkkpig
sfplnkitsirtkvdnlksleisvssvhistylftfktreereswqnnlesfrkimsmk