PDB entry 6f23

View 6f23 on RCSB PDB site
Description: Complex between MTH1 and compound 16 (a 4-amino-7-azaindole derivative)
Class: hydrolase
Keywords: nudix, nucleotide hydrolase, inhibitor, oncology, hydrolase
Deposited on 2017-11-23, released 2018-03-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-04-04, with a file datestamp of 2018-03-29.
Experiment type: XRAY
Resolution: 1.84 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 7,8-dihydro-8-oxoguanine triphosphatase
    Species: Homo sapiens [TaxId:9606]
    Gene: NUDT1, MTH1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P36639 (3-158)
      • expression tag (0-2)
    Domains in SCOPe 2.07: d6f23a1, d6f23a2
  • Chain 'B':
    Compound: 7,8-dihydro-8-oxoguanine triphosphatase
    Species: Homo sapiens [TaxId:9606]
    Gene: NUDT1, MTH1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6f23b_
  • Heterogens: C8Z, SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6f23A (A:)
    gshmgasrlytlvlvlqpqrvllgmkkrgfgagrwngfggkvqegetiedgarrelqees
    gltvdalhkvgqivfefvgepelmdvhvfctdsiqgtpvesdemrpcwfqldqipfkdmw
    pddsywfplllqkkkfhgyfkfqgqdtildytlrevdtv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6f23B (B:)
    gshmgasrlytlvlvlqpqrvllgmkkrgfgagrwngfggkvqegetiedgarrelqees
    gltvdalhkvgqivfefvgepelmdvhvfctdsiqgtpvesdemrpcwfqldqipfkdmw
    pddsywfplllqkkkfhgyfkfqgqdtildytlrevdtv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6f23B (B:)
    asrlytlvlvlqpqrvllgmkkrgfgagrwngfggkvqegetiedgarrelqeesgltvd
    alhkvgqivfefvgepelmdvhvfctdsiqgtpvesdemrpcwfqldqipfkdmwpddsy
    wfplllqkkkfhgyfkfqgqdtildytlrevdtv