PDB entry 6f21

View 6f21 on RCSB PDB site
Description: crystal structure of toxin mt9 from mamba venom
Deposited on 2017-11-23, released 2018-12-12
Made obsolete by 6r5m on 2020-02-05

The last revision was dated 2020-02-05, with a file datestamp of 2020-01-31.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dendroaspis polylepis MT9
    Species: Dendroaspis polylepis, synthetic [TaxId:8624]
    Database cross-references and differences (RAF-indexed):
    • PDB 6F21 (0-56)
  • Chain 'B':
    Compound: Dendroaspis polylepis MT9
    Species: Dendroaspis polylepis, synthetic [TaxId:8624]
    Database cross-references and differences (RAF-indexed):
    • PDB 6F21 (0-56)
  • Chain 'C':
    Compound: Dendroaspis polylepis MT9
    Species: Dendroaspis polylepis, synthetic [TaxId:8624]
    Database cross-references and differences (RAF-indexed):
    • PDB 6F21 (0-56)
  • Heterogens: SO4, PGO, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6f21A (A:)
tichiqiskthgilktceenscykmsvrgwiigrgcgcpsavrprqvqcctsdkcny

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >6f21B (B:)
tichiqiskthgilktceenscykmsvrgwiigrgcgcpsavrprqvqcctsdkcny

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records:
    >6f21C (C:)
tichiqiskthgilktceenscykmsvrgwiigrgcgcpsavrprqvqcctsdkcny