PDB entry 6f1w

View 6f1w on RCSB PDB site
Description: Crystal structure of human Casein Kinase I delta in complex with compound 31a
Class: transferase
Keywords: Kinase, Inhibitor, Complex, CK1, transferase
Deposited on 2017-11-23, released 2019-03-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-03-13, with a file datestamp of 2019-03-08.
Experiment type: XRAY
Resolution: 1.86 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Casein kinase I isoform delta
    Species: Homo sapiens [TaxId:9606]
    Gene: CSNK1D, HCKID
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6f1wa_
  • Chain 'B':
    Compound: Casein kinase I isoform delta
    Species: Homo sapiens [TaxId:9606]
    Gene: CSNK1D, HCKID
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6f1wb_
  • Heterogens: SO4, CG5, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6f1wA (A:)
    mgsshhhhhhssglvprgshmelrvgnryrlgrkigsgsfgdiylgtdiaageevaikle
    cvktkhpqlhieskiykmmqggvgiptirwcgaegdynvmvmellgpsledlfnfcsrkf
    slktvllladqmisrieyihsknfihrdvkpdnflmglgkkgnlvyiidfglakkyrdar
    thqhipyrenknltgtaryasinthlgieqsrrddleslgyvlmyfnlgslpwqglkaat
    krqkyerisekkmstpievlckgypsefatylnfcrslrfddkpdysylrqlfrnlfhrq
    gfsydyvfdwnmlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6f1wA (A:)
    lrvgnryrlgrkigsggdiylgtdiaageevaiklecvkpqlhieskiykmmqggvgipt
    irwcgaegdynvmvmellgpsledlfnfcsrkfslktvllladqmisrieyihsknfihr
    dvkpdnflmglgkkgnlvyiidfglakkyrdarthqhipyrenknltgtaryasinthlg
    ieqsrrddleslgyvlmyfnlgslpwqglkaatkrqkyerisekkmstpievlckgypse
    fatylnfcrslrfddkpdysylrqlfrnlfhrqgfsydyvfdwnm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6f1wB (B:)
    mgsshhhhhhssglvprgshmelrvgnryrlgrkigsgsfgdiylgtdiaageevaikle
    cvktkhpqlhieskiykmmqggvgiptirwcgaegdynvmvmellgpsledlfnfcsrkf
    slktvllladqmisrieyihsknfihrdvkpdnflmglgkkgnlvyiidfglakkyrdar
    thqhipyrenknltgtaryasinthlgieqsrrddleslgyvlmyfnlgslpwqglkaat
    krqkyerisekkmstpievlckgypsefatylnfcrslrfddkpdysylrqlfrnlfhrq
    gfsydyvfdwnmlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6f1wB (B:)
    melrvgnryrlgrkigdiylgtdiaageevaiklecvlhieskiykmmqggvgiptirwc
    gaegdynvmvmellgpsledlfnfcsrkfslktvllladqmisrieyihsknfihrdvkp
    dnflmglgkkgnlvyiidfglakkyrdarthqhipyrenknltgtaryasinthlgieqs
    rrddleslgyvlmyfnlgslpwqglkaatkrqkyerisekkmstpievlckgypsefaty
    lnfcrslrfddkpdysylrqlfrnlfhrqgfsydyvfdwn