PDB entry 6f1k

View 6f1k on RCSB PDB site
Description: structure of artd2/parp2 wgr domain bound to double strand dna without 5'phosphate
Deposited on 2017-11-22, released 2018-10-10
The last revision was dated 2019-10-16, with a file datestamp of 2019-10-11.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Poly [ADP-ribose] polymerase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: PARP2, ADPRT2, ADPRTL2
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: DNA (5'-d(*gp*cp*cp*tp*ap*gp*cp*tp*ap*cp*gp*tp*ap*gp*cp*tp*ap*gp*gp*c)-3')
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
  • Heterogens: GOL, CL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6f1kA (A:)
    gkapvdpectakvgkahvycegndvydvmlnqtnlqfnnnkyyliqlleddaqrnfsvwm
    rwgrvgkmgqhslvacsgnlnkakeifqkkfldktknnwedrekfekvpgkydmlqmdya
    tntqdeeet
    

    Sequence, based on observed residues (ATOM records):
    >6f1kA (A:)
    kapvdpectakvgkahvycegndvydvmlnqtnlqfnnnkyyliqlleddaqrnfsvwmr
    wgrvgkmgqhslvacsgnlnkakeifqkkfldktknnwedrekfekvpgkydmlqmdya
    

  • Chain 'C':
    No sequence available.