PDB entry 6f1g

View 6f1g on RCSB PDB site
Description: The structure of AbnB-E201A, an intracellular 1,5-alpha-L-arabinanase from Geobacillus stearothermophilus, in complex with arabinopentaose
Class: hydrolase
Keywords: arabinopentaose, geobacillus stearothermophilus, intracellular arabinanase, gh43, glycoside hydrolase, HYDROLASE
Deposited on 2017-11-21, released 2018-12-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 1.67 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Intracellular endo-alpha-(1->5)-L-arabinanase
  Species: Geobacillus stearothermophilus [TaxId:1422]
  Gene: abnB
  Database cross-references and differences (RAF-indexed):
  • Uniprot B3EYM8 (0-314)
    • conflict (8)
    • conflict (200)
  Domains in SCOPe 2.08: d6f1ga_
• Heterogens: CA, SO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6f1gA (A:)
  mvhfhpfggvnfyemdwslkgdlwahdpviakegsrwyvfhtgsgiqiktsedgvhwenm
  gwvfpslpdwykqyvpekdedhlwapdicfyngiyylyysvstfgkntsviglatnqtld
  prdpdyewkdmgpvihstasdnynaidpnvvfdqegqpwlsfgsfwsgiqliqldtetmk
  paaqaelltiasrgeepnaiaapfivcrngyyylfvsfdfccrgiestykiavgrskdit
  gpyvdkngvsmmqgggtildegndrwigpghcavyfsgvsailvnhaydalkngeptlqi
  rplywddegwpylsv