PDB entry 6f1g

View 6f1g on RCSB PDB site
Description: The structure of AbnB-E201A, an intracellular 1,5-alpha-L-arabinanase from Geobacillus stearothermophilus, in complex with arabinopentaose
Class: hydrolase
Keywords: arabinopentaose, geobacillus stearothermophilus, intracellular arabinanase, gh43, glycoside hydrolase, HYDROLASE
Deposited on 2017-11-21, released 2018-12-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-12-12, with a file datestamp of 2018-12-07.
Experiment type: XRAY
Resolution: 1.67 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Intracellular endo-alpha-(1->5)-L-arabinanase
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Gene: abnB
    Database cross-references and differences (RAF-indexed):
    • Uniprot B3EYM8 (0-314)
      • conflict (8)
      • conflict (200)
    Domains in SCOPe 2.07: d6f1ga_
  • Heterogens: CA, SO4, AHR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6f1gA (A:)
    mvhfhpfggvnfyemdwslkgdlwahdpviakegsrwyvfhtgsgiqiktsedgvhwenm
    gwvfpslpdwykqyvpekdedhlwapdicfyngiyylyysvstfgkntsviglatnqtld
    prdpdyewkdmgpvihstasdnynaidpnvvfdqegqpwlsfgsfwsgiqliqldtetmk
    paaqaelltiasrgeepnaiaapfivcrngyyylfvsfdfccrgiestykiavgrskdit
    gpyvdkngvsmmqgggtildegndrwigpghcavyfsgvsailvnhaydalkngeptlqi
    rplywddegwpylsv