PDB entry 6f1d

View 6f1d on RCSB PDB site
Description: cub2 domain of c1r
Deposited on 2017-11-21, released 2018-01-17
The last revision was dated 2018-01-31, with a file datestamp of 2018-01-26.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Complement C1r subcomponent
    Species: Homo sapiens [TaxId:9606]
    Gene: C1R
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00736 (0-116)
      • conflict (52)
      • conflict (55-56)
      • conflict (58)
  • Heterogens: CA, NA, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6f1dA (A:)
aecsselyteasgyissleyprsyppdlrcnysirvergltlhlkflepfdiedhpevpc
pydqlqiyangknigefcgkqrppdldtssnavdllfftdesgdsrgwklrytteii