PDB entry 6f0y

View 6f0y on RCSB PDB site
Description: rtt109 peptide bound to asf1
Deposited on 2017-11-21, released 2017-12-27
The last revision was dated 2019-05-08, with a file datestamp of 2019-05-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: histone chaperone asf1
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: ASF1, CIA1, YJL115W, J0755
    Database cross-references and differences (RAF-indexed):
    • Uniprot P32447 (4-171)
      • expression tag (0-3)
  • Chain 'B':
    Compound: histone acetyltransferase Rtt109 C-terminus
    Species: Saccharomyces cerevisiae S288c, synthetic [TaxId:559292]
    Database cross-references and differences (RAF-indexed):
    • PDB 6F0Y (0-14)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6f0yA (A:)
gamgsivsllgikvlnnpakftdpyefeitfecleslkhdlewkltyvgssrsldhdqel
dsilvgpvpvgvnkfvfsadppsaelipaselvsvtvillscsydgrefvrvgyyvnney
deeelrenppakvqvdhivrnilaekprvtrfnivwdnenegdlyppeqpgv

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >6f0yB (B:)
laitmlkprkkakal