PDB entry 6f0d

View 6f0d on RCSB PDB site
Description: crystal structure of a llama vhh antibody bcd090-m2 against human erbb3 in space group p1 with cadmium ions
Deposited on 2017-11-19, released 2017-11-29
The last revision was dated 2018-11-28, with a file datestamp of 2018-11-23.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: VHH antibody BCD090-M2
    Species: Lama glama [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 6F0D (0-127)
  • Chain 'B':
    Compound: VHH antibody BCD090-M2
    Species: Lama glama [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 6F0D (0-127)
  • Heterogens: CD, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6f0dA (A:)
gqvqlvqsggglvqaggslrlscafsgrtfsmytmgwfrqapgkerefvaanrgrglspd
iadsvngrftisrdnakntlylqmdslkpedtavyycaadlqygsswpqrssaeydywgq
gttvtvss

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >6f0dB (B:)
gqvqlvqsggglvqaggslrlscafsgrtfsmytmgwfrqapgkerefvaanrgrglspd
iadsvngrftisrdnakntlylqmdslkpedtavyycaadlqygsswpqrssaeydywgq
gttvtvss