PDB entry 6f0c

View 6f0c on RCSB PDB site
Description: Cytochrome P450 TxtC employs substrate conformational switching for sequential aliphatic and aromatic thaxtomin hydroxylation
Class: oxidoreductase
Keywords: Cytochrome P450, TxtC, Thaxtomin hydroxylation, OXIDOREDUCTASE
Deposited on 2017-11-17, released 2018-12-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-12-12, with a file datestamp of 2018-12-07.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome p450 monooxygenase
    Species: Streptomyces acidiscabies 84-104 [TaxId:1116232]
    Gene: txtC, a10_01524
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6f0ca_
  • Heterogens: HEM, C8B, OXY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6f0cA (A:)
    mespatqvdpansplepyhiypeakscpvakvglwngtpahvfsgyedvrtvlqdrrfss
    dsrrpnfteltptlqsqaaappfvrtdnpdhrrlrgtiareflpkhiellrpaireivqg
    vldglaetappqdmleafavpvasatvfrllgipaedralltrcvkgvvsavgsedegae
    vfrtlgeyigglvqdpselpedslirrlvtgpyqekqltfhetigvilmlivggydttas
    tislslvsyalqpekfsvvhehperipllveellryhtvsqlglgriatedvevggvtvr
    agqmvvaalplanrdesvfpnpdeldfdrpsvphvgfgygphqcvgqalarvelqeaipa
    virrlpgmrlacaledlpfrhdmatygihelpmtw
    

    Sequence, based on observed residues (ATOM records): (download)
    >6f0cA (A:)
    splepyhiypeakscpvakvglwngtpahvfsgyedvrtvlqdrrfssdsrrpnfteltp
    tlqsqaaappfvrtdnpdhrrlrgtiareflpkhiellrpaireivqgvldglaetappq
    dmleafavpvasatvfrllgipaedralltrcvkgvvsavgsedegaevfrtlgeyiggl
    vqdpselpedslirrlvtgpyqekqltfhetigvilmlivggydttastislslvsyalq
    pekfsvvhehperipllveellryhtvsqlglgriatedvevggvtvragqmvvaalpla
    nrdesvfpnpdeldfdrpsvphvgfgygphqcvgqalarvelqeaipavirrlpgmrlac
    aledlpfrhdmatygihelpmtw