PDB entry 6f07

View 6f07 on RCSB PDB site
Description: cbf3 core complex
Deposited on 2017-11-17, released 2017-12-13
The last revision was dated 2019-12-11, with a file datestamp of 2019-12-06.
Experiment type: EM
Resolution: 3.6 Å
R-factor: N/A
AEROSPACI score: 0.1 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Centromere DNA-binding protein complex CBF3 subunit B
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: CEP3, CBF3, CBF3B, CSL1, YMR168C, YM8520.17C
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Centromere DNA-binding protein complex CBF3 subunit B
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: CEP3, CBF3, CBF3B, CSL1, YMR168C, YM8520.17C
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Suppressor of kinetochore protein 1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: SKP1, CBF3D, YDR328C, D9798.14
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ZN

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6f07A (A:)
    mfnrttqlkskhpcsvctrrkvkcdrmipcgncrkrgqdsecmkstklitassskeylpd
    lllfwqnyeywitniglyktkqrdltrtpanldtdteecmfwmnylqkdqsfqlmnfame
    nlgalyfgsigdiselylrveqywdrradknhsvdgkywdaliwsvftmciyympvekla
    eifsvyplheylgsnkrlnwedgmqlvmcqnfarcslfqlkqcdfmahpdirlvqaylil
    atttfpydepllanslltqcihtfknfhvddfrpllnddpvesiakvtlgrifyrlcgcd
    ylqsgprkpialhtevssllqhaaylqdlpnvdvyreenstevlywkiisldrdldqyln
    ksskpplktldairreldifqykvdsleedfrsnnsrfqkfialfqistvswklfkmyli
    yydtadsllkvihyskviislivnnfhakseffnrhpmvmqtitrvvsfisfyqifvesa
    avkqllvdlteltanlptifgskldklvylterlsklkllwdkvqlldsgdsfyhpvfki
    lqndikiielkndemfslikglgslvplnklrqeslleeedenntepsdfrtiveefqse
    ynisdilsgsggsgenlyfq
    

    Sequence, based on observed residues (ATOM records):
    >6f07A (A:)
    keylpdlllfwqnyeywitniglyktkqrdltrtpanldtdteecmfwmnylqkdqsfql
    mnfamenlgalyfgsigdiselylrveqywdrradknhsvdgkywdaliwsvftmciyym
    pveklaeifsvyplheylgsnkrlnwedgmqlvmcqnfarcslfqlkqcdfmahpdirlv
    qaylilatttfpydepllanslltqcihtfknfhvddfrpllnddpvesiakvtlgrify
    rlcgcdylqsgprkpialhreenstevlywkiisldrdldqylnksskpplktldairre
    ldifqykvdsleedfrsnnsrfqkfialfqistvswklfkmyliyydtadsllkvihysk
    viislivnnfhakseffnrhpmvmqtitrvvsfisfyqifvesaavkqllvdlteltanl
    ptifgskldklvylterlsklkllwdkvqlldsgdsfyhpvfkilqndikiielkndemf
    slikglgslsdfrtiveefqseynisdils
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >6f07B (B:)
    mfnrttqlkskhpcsvctrrkvkcdrmipcgncrkrgqdsecmkstklitassskeylpd
    lllfwqnyeywitniglyktkqrdltrtpanldtdteecmfwmnylqkdqsfqlmnfame
    nlgalyfgsigdiselylrveqywdrradknhsvdgkywdaliwsvftmciyympvekla
    eifsvyplheylgsnkrlnwedgmqlvmcqnfarcslfqlkqcdfmahpdirlvqaylil
    atttfpydepllanslltqcihtfknfhvddfrpllnddpvesiakvtlgrifyrlcgcd
    ylqsgprkpialhtevssllqhaaylqdlpnvdvyreenstevlywkiisldrdldqyln
    ksskpplktldairreldifqykvdsleedfrsnnsrfqkfialfqistvswklfkmyli
    yydtadsllkvihyskviislivnnfhakseffnrhpmvmqtitrvvsfisfyqifvesa
    avkqllvdlteltanlptifgskldklvylterlsklkllwdkvqlldsgdsfyhpvfki
    lqndikiielkndemfslikglgslvplnklrqeslleeedenntepsdfrtiveefqse
    ynisdilsgsggsgenlyfq
    

    Sequence, based on observed residues (ATOM records):
    >6f07B (B:)
    nrttqlkskhpcsvctrrkvkcdrmipcgncrkrgqdsecmkstklitassskeylpdll
    lfwqnyeywitniglyktkqrdltrtpanldtdteecmfwmnylqkdqsfqlmnfamenl
    galyfgsigdiselylrveqywdrradknhsvdgkywdaliwsvftmciyympveklaei
    fsvyplheylgsnkrlnwedgmqlvmcqnfarcslfqlkqcdfmahpdirlvqaylilat
    ttfpydepllanslltqcihtfknfhvddfrpllnddpvesiakvtlgrifyrlcgcdyl
    qsgprkpialhtevssllvyreenstevlywkiisldrdldqylnksskpplktldairr
    eldifqykvdsleedfrsnnsrfqkfialfqistvswklfkmyliyydtadsllkvihys
    kviislivnnfhakseffnrhpmvmqtitrvvsfisfyqifvesaavkqllvdlteltan
    lptifgskldklvylterlsklkllwdkvqlldsgdsfyhpvfkilqndikiielkndem
    fslikglgslvplnsdfrtiveefqseynisdils
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >6f07D (D:)
    mvtsnvvlvsgegerftvdkkiaerslllknylndmhdsnlqnnsdsesdsdsetnhksk
    dnnngddddedddeivmpvpnvrssvlqkviewaehhrdsnfpdeddddsrksapvdswd
    reflkvdqemlyeiilaanylnikplldagckvvaemirgrspeeirrtfnivndftpee
    eaairrenewaedr
    

    Sequence, based on observed residues (ATOM records):
    >6f07D (D:)
    tsnvvlvsgegerftvdkkiaerslllknylndivmpvpnvrssvlqkviewaehhrdsn
    fpdeddddsrksapvdswdreflkvdqemlyeiilaanylnikplldagckvvaemirgr
    speeirrtfdftpeeeaairre