PDB entry 6f05

View 6f05 on RCSB PDB site
Description: arabidopsis thaliana gstf9, gso3 bound
Class: transferase
Keywords: transferase, phi class, peroxidase, gso3
Deposited on 2017-11-17, released 2018-08-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-15, with a file datestamp of 2018-08-10.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glutathione S-transferase F9
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: GSTF9, GLUTTR, GSTF7, At2g30860, F7F1.7
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6f05a1, d6f05a2
  • Chain 'B':
    Compound: Glutathione S-transferase F9
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: GSTF9, GLUTTR, GSTF7, At2g30860, F7F1.7
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6f05b1, d6f05b2
  • Chain 'C':
    Compound: Glutathione S-transferase F9
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: GSTF9, GLUTTR, GSTF7, At2g30860, F7F1.7
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6f05c1, d6f05c2
  • Chain 'D':
    Compound: Glutathione S-transferase F9
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: GSTF9, GLUTTR, GSTF7, At2g30860, F7F1.7
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6f05d1, d6f05d2
  • Chain 'E':
    Compound: Glutathione S-transferase F9
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: GSTF9, GLUTTR, GSTF7, At2g30860, F7F1.7
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6f05e1, d6f05e2
  • Chain 'F':
    Compound: Glutathione S-transferase F9
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: GSTF9, GLUTTR, GSTF7, At2g30860, F7F1.7
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6f05f1, d6f05f2
  • Chain 'G':
    Compound: Glutathione S-transferase F9
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: GSTF9, GLUTTR, GSTF7, At2g30860, F7F1.7
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6f05g1, d6f05g2
  • Chain 'H':
    Compound: Glutathione S-transferase F9
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: GSTF9, GLUTTR, GSTF7, At2g30860, F7F1.7
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6f05h1, d6f05h2
  • Chain 'I':
    Compound: Glutathione S-transferase F9
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: GSTF9, GLUTTR, GSTF7, At2g30860, F7F1.7
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6f05i1, d6f05i2
  • Chain 'J':
    Compound: Glutathione S-transferase F9
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: GSTF9, GLUTTR, GSTF7, At2g30860, F7F1.7
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6f05j1, d6f05j2
  • Heterogens: GTS, GOL, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6f05A (A:)
    mvlkvygphfaspkralvtliekgvafetipvdlmkgehkqpaylalqpfgtvpavvdgd
    ykifesravmryvaekyrsqgpdllgktvedrgqveqwldveattyhppllnltlhimfa
    svmgfpsdeklikeseeklagvldvyeahlskskylagdfvsladlahlpftdylvgpig
    kaymikdrkhvsawwddissrpawketvakysfpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >6f05A (A:)
    vlkvygphfaspkralvtliekgvafetipvdlmkgehkqpaylalqpfgtvpavvdgdy
    kifesravmryvaekyrsqgpdllgktvedrgqveqwldveattyhppllnltlhimfde
    klikeseeklagvldvyeahlskskylagdfvsladlahlpftdylvgpigkaymikdrk
    hvsawwddissrpawketvakysf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6f05B (B:)
    mvlkvygphfaspkralvtliekgvafetipvdlmkgehkqpaylalqpfgtvpavvdgd
    ykifesravmryvaekyrsqgpdllgktvedrgqveqwldveattyhppllnltlhimfa
    svmgfpsdeklikeseeklagvldvyeahlskskylagdfvsladlahlpftdylvgpig
    kaymikdrkhvsawwddissrpawketvakysfpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >6f05B (B:)
    vlkvygphfaspkralvtliekgvafetipvdlmkgehkqpaylalqpfgtvpavvdgdy
    kifesravmryvaekyrsqgpdllgktvedrgqveqwldveattyhppllnltlhimdek
    likeseeklagvldvyeahlskskylagdfvsladlahlpftdylvgpigkaymikdrkh
    vsawwddissrpawketvakysfpa
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6f05C (C:)
    mvlkvygphfaspkralvtliekgvafetipvdlmkgehkqpaylalqpfgtvpavvdgd
    ykifesravmryvaekyrsqgpdllgktvedrgqveqwldveattyhppllnltlhimfa
    svmgfpsdeklikeseeklagvldvyeahlskskylagdfvsladlahlpftdylvgpig
    kaymikdrkhvsawwddissrpawketvakysfpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >6f05C (C:)
    vlkvygphfaspkralvtliekgvafetipvdlmkgehkqpaylalqpfgtvpavvdgdy
    kifesravmryvaekyrsqgpdllgktvedrgqveqwldveattyhppllnltlhidekl
    ikeseeklagvldvyeahlskskylagdfvsladlahlpftdylvgpigkaymikdrkhv
    sawwddissrpawketvakysf
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6f05D (D:)
    mvlkvygphfaspkralvtliekgvafetipvdlmkgehkqpaylalqpfgtvpavvdgd
    ykifesravmryvaekyrsqgpdllgktvedrgqveqwldveattyhppllnltlhimfa
    svmgfpsdeklikeseeklagvldvyeahlskskylagdfvsladlahlpftdylvgpig
    kaymikdrkhvsawwddissrpawketvakysfpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >6f05D (D:)
    vlkvygphfaspkralvtliekgvafetipvdlmkgehkqpaylalqpfgtvpavvdgdy
    kifesravmryvaekyrsqgpdllgktvedrgqveqwldveattyhppllnltleklike
    seeklagvldvyeahlskskylagdfvsladlahlpftdylvgpigkaymikdrkhvsaw
    wddissrpawketvakysf
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6f05E (E:)
    mvlkvygphfaspkralvtliekgvafetipvdlmkgehkqpaylalqpfgtvpavvdgd
    ykifesravmryvaekyrsqgpdllgktvedrgqveqwldveattyhppllnltlhimfa
    svmgfpsdeklikeseeklagvldvyeahlskskylagdfvsladlahlpftdylvgpig
    kaymikdrkhvsawwddissrpawketvakysfpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >6f05E (E:)
    vlkvygphfaspkralvtliekgvafetipvdlmkgehkqpaylalqpfgtvpavvdgdy
    kifesravmryvaekyrsqgpdllgktvedrgqveqwldveattyhppllnltlhiekli
    keseeklagvldvyeahlskskylagdfvsladlahlpftdylvgpigkaymikdrkhvs
    awwddissrpawketvakysf
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >6f05F (F:)
    mvlkvygphfaspkralvtliekgvafetipvdlmkgehkqpaylalqpfgtvpavvdgd
    ykifesravmryvaekyrsqgpdllgktvedrgqveqwldveattyhppllnltlhimfa
    svmgfpsdeklikeseeklagvldvyeahlskskylagdfvsladlahlpftdylvgpig
    kaymikdrkhvsawwddissrpawketvakysfpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >6f05F (F:)
    vlkvygphfaspkralvtliekgvafetipvdlmkgehkqpaylalqpfgtvpavvdgdy
    kifesravmryvaekyrsqgpdllgktvedrgqveqwldveattyhppllnltlhisdek
    likeseeklagvldvyeahlskskylagdfvsladlahlpftdylvgpigkaymikdrkh
    vsawwddissrpawketvakysf
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >6f05G (G:)
    mvlkvygphfaspkralvtliekgvafetipvdlmkgehkqpaylalqpfgtvpavvdgd
    ykifesravmryvaekyrsqgpdllgktvedrgqveqwldveattyhppllnltlhimfa
    svmgfpsdeklikeseeklagvldvyeahlskskylagdfvsladlahlpftdylvgpig
    kaymikdrkhvsawwddissrpawketvakysfpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >6f05G (G:)
    lkvygphfaspkralvtliekgvafetipvdlmkgehkqpaylalqpfgtvpavvdgdyk
    ifesravmryvaekyrsqgpdllgktvedrgqveqwldveattyhppllnltldeklike
    seeklagvldvyeahlskskylagdfvsladlahlpftdylvgpigkaymikdrkhvsaw
    wddissrpawketvakys
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >6f05H (H:)
    mvlkvygphfaspkralvtliekgvafetipvdlmkgehkqpaylalqpfgtvpavvdgd
    ykifesravmryvaekyrsqgpdllgktvedrgqveqwldveattyhppllnltlhimfa
    svmgfpsdeklikeseeklagvldvyeahlskskylagdfvsladlahlpftdylvgpig
    kaymikdrkhvsawwddissrpawketvakysfpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >6f05H (H:)
    vlkvygphfaspkralvtliekgvafetipvdlmkgehkqpaylalqpfgtvpavvdgdy
    kifesravmryvaekyrsqgpdllgktvedrgqveqwldveattyhppllnltlhimfli
    keseeklagvldvyeahlskskylagdfvsladlahlpftdylvgpigkaymikdrkhvs
    awwddissrpawketvakysf
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >6f05I (I:)
    mvlkvygphfaspkralvtliekgvafetipvdlmkgehkqpaylalqpfgtvpavvdgd
    ykifesravmryvaekyrsqgpdllgktvedrgqveqwldveattyhppllnltlhimfa
    svmgfpsdeklikeseeklagvldvyeahlskskylagdfvsladlahlpftdylvgpig
    kaymikdrkhvsawwddissrpawketvakysfpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >6f05I (I:)
    vlkvygphfaspkralvtliekgvafetipvdlmkgehkqpaylalqpfgtvpavvdgdy
    kifesravmryvaekyrsqgpdllgktvedrgqveqwldveattyhppllnltlhimfas
    deklikeseeklagvldvyeahlskskylagdfvsladlahlpftdylvgpigkaymikd
    rkhvsawwddissrpawketvakysf
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >6f05J (J:)
    mvlkvygphfaspkralvtliekgvafetipvdlmkgehkqpaylalqpfgtvpavvdgd
    ykifesravmryvaekyrsqgpdllgktvedrgqveqwldveattyhppllnltlhimfa
    svmgfpsdeklikeseeklagvldvyeahlskskylagdfvsladlahlpftdylvgpig
    kaymikdrkhvsawwddissrpawketvakysfpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >6f05J (J:)
    vlkvygphfaspkralvtliekgvafetipvdlmkgehkqpaylalqpfgtvpavvdgdy
    kifesravmryvaekyrsqgpdllgktvedrgqveqwldveattyhppllnltkeseekl
    agvldvyeahlskskylagdfvsladlahlpftdylvgpigkaymikdrkhvsawwddis
    srpawketvakys