PDB entry 6ezy

View 6ezy on RCSB PDB site
Description: arabidopsis thaliana gstf9, gsh and gsoh bound
Class: transferase
Keywords: transferase, phi class, peroxidase, gsh, gsoh
Deposited on 2017-11-16, released 2018-08-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-15, with a file datestamp of 2018-08-10.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glutathione S-transferase F9
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: GSTF9, GLUTTR, GSTF7, At2g30860, F7F1.7
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ezya1, d6ezya2
  • Chain 'B':
    Compound: Glutathione S-transferase F9
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: GSTF9, GLUTTR, GSTF7, At2g30860, F7F1.7
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ezyb1, d6ezyb2
  • Heterogens: GOL, BR, GSH, GS8, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6ezyA (A:)
    mvlkvygphfaspkralvtliekgvafetipvdlmkgehkqpaylalqpfgtvpavvdgd
    ykifesravmryvaekyrsqgpdllgktvedrgqveqwldveattyhppllnltlhimfa
    svmgfpsdeklikeseeklagvldvyeahlskskylagdfvsladlahlpftdylvgpig
    kaymikdrkhvsawwddissrpawketvakysfpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ezyA (A:)
    vlkvygphfaspkralvtliekgvafetipvdlmkgehkqpaylalqpfgtvpavvdgdy
    kifesravmryvaekyrsqgpdllgktvedrgqveqwldveattyhppllnltlhimfas
    vmgfpsdeklikeseeklagvldvyeahlskskylagdfvsladlahlpftdylvgpigk
    aymikdrkhvsawwddissrpawketvakys
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6ezyB (B:)
    mvlkvygphfaspkralvtliekgvafetipvdlmkgehkqpaylalqpfgtvpavvdgd
    ykifesravmryvaekyrsqgpdllgktvedrgqveqwldveattyhppllnltlhimfa
    svmgfpsdeklikeseeklagvldvyeahlskskylagdfvsladlahlpftdylvgpig
    kaymikdrkhvsawwddissrpawketvakysfpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ezyB (B:)
    vlkvygphfaspkralvtliekgvafetipvdlmkgehkqpaylalqpfgtvpavvdgdy
    kifesravmryvaekyrsqgpdllgktvedrgqveqwldveattyhppllnltlhimfas
    vmgfpsdeklikeseeklagvldvyeahlskskylagdfvsladlahlpftdylvgpigk
    aymikdrkhvsawwddissrpawketvakysf