PDB entry 6ezp

View 6ezp on RCSB PDB site
Description: CATHEPSIN L IN COMPLEX WITH (3S,14E)-19-chloro-N-(1-cyanocyclopropyl)-5-oxo-12,17-dioxa-4-azatricyclo[16.2.2.06,11]docosa-1(21),6(11),7,9,14,18(22),19-heptaene-3-carboxamide
Class: hydrolase
Keywords: protease inhibitor, hydrolase-hydrolase inhibitor complex, hydrolase
Deposited on 2017-11-16, released 2018-04-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-04-11, with a file datestamp of 2018-04-06.
Experiment type: XRAY
Resolution: 1.37 Å
R-factor: N/A
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cathepsin L1
    Species: Homo sapiens [TaxId:9606]
    Gene: CTSL, CTSL1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ezpa_
  • Heterogens: C3E, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6ezpA (A:)
    aprsvdwrekgyvtpvknqgqcgscwafsatgalegqmfrktgrlislseqnlvdcsgpq
    gnegcngglmdyafqyvqdnggldseesypyeateesckynpkysvandtgfvdipkqek
    almkavatvgpisvaidaghesflfykegiyfepdcssedmdhgvlvvgygfestesdnn
    kywlvknswgeewgmggyvkmakdrrnhcgiasaasyptv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ezpA (A:)
    aprsvdwrekgyvtpvknqgqcgscwafsatgalegqmfrktgrlislseqnlvdcsgpq
    gnegcngglmdyafqyvqdnggldseesypyeateesckynpkysvandtgfvdipkqek
    almkavatvgpisvaidaghesflfykegiyfepdcssedmdhgvlvvgygfestnnkyw
    lvknswgeewgmggyvkmakdrrnhcgiasaasyptv