PDB entry 6ezf

View 6ezf on RCSB PDB site
Description: PDE2 in complex with molecule 5
Class: hydrolase
Keywords: pde2, hydrolase
Deposited on 2017-11-15, released 2018-04-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-04-04, with a file datestamp of 2018-03-29.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cGMP-dependent 3',5'-cyclic phosphodiesterase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O00408 (Start-344)
      • expression tag (345-346)
    Domains in SCOPe 2.07: d6ezfa1, d6ezfa2
  • Heterogens: MG, ZN, C6Z, GOL, SO4, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6ezfA (A:)
    mhasddeytkllhdgiqpvaaidsnfasftytprslpeddtsmailsmlqdmnfinnyki
    dcptlarfclmvkkgyrdppyhnwmhafsvshfcyllyknleltnyledieifalfiscm
    chdldhrgtnnsfqvasksvlaalyssegsvmerhhfaqaiailnthgcnifdhfsrkdy
    qrmldlmrdiilatdlahhlrifkdlqkmaevgydrnnkqhhrlllcllmtscdlsdqtk
    gwkttrkiaeliykeffsqgdlekamgnrpmemmdrekayipelqisfmehiampiykll
    qdlfpkaaelyervasnrehwtkvshkftirglpsnnsldfldeelehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ezfA (A:)
    deytkllhdgiqpvaaidsnfasftytprslpeddtsmailsmlqdmnfinnykidcptl
    arfclmvkkgyrdppyhnwmhafsvshfcyllyknleltnyledieifalfiscmchdld
    hrgtnnsfqvasksvlaalyssegsvmerhhfaqaiailnthgcnifdhfsrkdyqrmld
    lmrdiilatdlahhlrifkdlqkmaevgydrnnkqhhrlllcllmtscdlsdqtkgwktt
    rkiaeliykeffsqgdlekamgnrpmemmdrekayipelqisfmehiampiykllqdlfp
    kaaelyervasnrehwtkvshkftirglpsnnsldfldeele