PDB entry 6ezc

View 6ezc on RCSB PDB site
Description: crystal structure of human trna-dihydrouridine(20) synthase catalytic domain e294k q305k double mutant
Deposited on 2017-11-14, released 2018-09-26
The last revision was dated 2018-09-26, with a file datestamp of 2018-09-21.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tRNA-dihydrouridine(20) synthase [NAD(P)+]-like
    Species: Homo sapiens [TaxId:9606]
    Gene: DUS2, DUS2L
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NX74 (7-End)
      • expression tag (4-6)
      • engineered mutation (287)
      • engineered mutation (298)
  • Heterogens: FMN, SO4, CL, GOL, PGE, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6ezcA (A:)
    mhhhhhhlilapmvrvgtlpmrllaldygadivyceelidlkmiqckrvvnevlstvdfv
    apddrvvfrtcereqnrvvfqmgtsdaeralavarlvendvagidvnmgcpkqystkggm
    gaallsdpdkiekilstlvkgtrrpvtckirilpsledtlslvkriertgiaaiavhgrk
    reerpqhpvscevikaiadtlsipvianggshdhiqqysdiedfrqataassvmvaraam
    wnpsiflkeglrpleevmqkyiryavqydnhytntkyclcqmlreqlkspqgrllhaaks
    sreiceafglgafyeettqeldaqqar
    

    Sequence, based on observed residues (ATOM records):
    >6ezcA (A:)
    hhhlilapmvrvgtlpmrllaldygadivyceelidlkmiqckrvvnevlstvdfvapdd
    rvvfrtcereqnrvvfqmgtsdaeralavarlvendvagidvnmgmgaallsdpdkieki
    lstlvkgtrrpvtckirilpsledtlslvkriertgiaaiavhgrkreerpqhpvscevi
    kaiadtlsipvianggshdhiqqysdiedfrqataassvmvaraamwnpsiflkeglrpl
    eevmqkyiryavqydnhytntkyclcqmlreqlkspqgrllhaakssreiceafglgafy
    eettqeld