PDB entry 6ez7

View 6ez7 on RCSB PDB site
Description: Pes4 RRM3 Structure
Class: RNA binding protein
Keywords: RNA Recognition Motif (RRM), RNA BINDING PROTEIN
Deposited on 2017-11-14, released 2018-12-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-12-12, with a file datestamp of 2018-12-07.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein PES4
    Species: SACCHAROMYCES CEREVISIAE S288C [TaxId:559292]
    Gene: PES4, YFR023W
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39684 (0-82)
      • cloning artifact (0)
    Domains in SCOPe 2.08: d6ez7a1, d6ez7a2
  • Heterogens: PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6ez7A (A:)
    mnsifiknlptittrddilnffsevgpiksiylsnatkvkylwafvtyknssdsekaikr
    ynnfyfrgkkllvtraqdkeera
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ez7A (A:)
    mnsifiknlptittrddilnffsevgpiksiylsnatvkylwafvtyknssdsekaikry
    nnfyfrgkkllvtraqdkeera