PDB entry 6ez4

View 6ez4 on RCSB PDB site
Description: nmr structure of the c-terminal domain of the human rpap3 protein
Deposited on 2017-11-14, released 2018-04-18
The last revision was dated 2019-05-08, with a file datestamp of 2019-05-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RNA polymerase II-associated protein 3
    Species: Homo sapiens [TaxId:9606]
    Gene: RPAP3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9H6T3 (4-134)
      • expression tag (0-3)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6ez4A (A:)
gphmaqfattvlppipansfqlesdfrqlksspdmlyqylkqiepslypklfqknldpdv
fnqivkilhdfyiekekpllifeilqrlselkrfdmavmfmsetekkiaralfnhidksg
lkdssveelkkrygg