PDB entry 6eyw

View 6eyw on RCSB PDB site
Description: Structure of Yeast Myosin 5 Cargo Binding Domain in Trigonal Space Group
Class: transport protein
Keywords: Myosin V Globular Tail Domain Rab GTPases vesicle trafficking yeast myosin, TRANSPORT PROTEIN
Deposited on 2017-11-13, released 2018-11-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-11-21, with a file datestamp of 2018-11-16.
Experiment type: XRAY
Resolution: 2.88 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: Myosin-2
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: MYO2, CDC66, YOR326W, O6167
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6eywx_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >6eywX (X:)
    smgvnatqineelyrlledteilnqeitegllkgfevpdagvaiqlskrdvvyparilii
    vlsemwrfgltkqsesflaqvlttiqkvvtqlkgndlipsgvfwlanvrelysfvvfaln
    silteetfkngmtdeeykeyvslvtelkddfealsyniyniwlkklqkqlqkkainavvi
    seslpgfsagetsgflnkifanteeytmddiltffnsiywcmksfhienevfhavvttll
    nyvdaicfnelimkrnflswkrglqlnynvtrleewckthgltdgteclqhliqtakllq
    vrkytiedidilrgicysltpaqlqklisqyqvadyespipqeilryvadivkkeaalss
    sgndskghehsssifitpetgpftdpfsliktrkfdqveayipawlslpstkrivdlvaq
    qvvqdgh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6eywX (X:)
    atqineelyrlledteilnqeitegllkgfevpdagvaiqlskrdvvypariliivlsem
    wrfgltkqsesflaqvlttiqkvvtqlkgndlipsgvfwlanvrelysfvvfalnsilte
    etmtdeeykeyvslvtelkddfealsyniyniwlkklqkqlqkkainavvisesleytmd
    diltffnsiywcmksfhienevfhavvttllnyvdaicfnelimkrnflswkrglqlnyn
    vtrleewckthgltdgteclqhliqtakllqvrkytiedidilrgicysltpaqlqklis
    qyqvadyespipqeilryvadivkkeaalssifitpetgpftdpfsliktrkfdqveayi
    pawlslpstkrivdlvaqqvv