PDB entry 6eys

View 6eys on RCSB PDB site
Description: crystal structure of the periplasmic pyoverdine maturation protein pvdp
Deposited on 2017-11-13, released 2018-08-01
The last revision was dated 2018-10-03, with a file datestamp of 2018-09-28.
Experiment type: XRAY
Resolution: 2.09 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: PvdP
    Species: Pseudomonas aeruginosa UCBPP-PA14 [TaxId:208963]
    Gene: pvdP, PA14_33740
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: PvdP
    Species: Pseudomonas aeruginosa UCBPP-PA14 [TaxId:208963]
    Gene: pvdP, PA14_33740
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: PvdP
    Species: Pseudomonas aeruginosa UCBPP-PA14 [TaxId:208963]
    Gene: pvdP, PA14_33740
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: PvdP
    Species: Pseudomonas aeruginosa UCBPP-PA14 [TaxId:208963]
    Gene: pvdP, PA14_33740
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6eysA (A:)
    hhhhhhssglevlfqgtthrhltreeepqtpdeasldlaatdgirlgdrlrglwdlrlvg
    gdaelpglpreglqlvldvapkgrgligyldtperllaaepprfrvlgdllgassasirw
    rlvdqasgsvapthdcsavfdevwadyanagdgtlsgriqrlersplspnedfrfvavkr
    hfplaherivlnekllgwlvspqhrlfhqlwhasrdkwhrlsekqrnalrgvgwqpgpld
    rerdargprkdrnasgidfffmhrhmlhtarsmqdlpswerlprpvvpleydrpgfiryf
    dnpdgfsvppawvavdddeysewlhglksaeayhanflvwesqyqdpaylakltlgqfgs
    elelgmhdwlhmrwasvtrdpsngapvmtdrfpadfaprwfrpendflgdpfsshvnpvf
    wsfhgwiddriedwyraherfhpgevqrrevegiqwfapgrwvevgdpwlgpathgcgls
    dvqassnsveldvetmklalriifseedqlsgwlkraprrpwyarnlklardqlrr
    

    Sequence, based on observed residues (ATOM records):
    >6eysA (A:)
    pqtpdeasldlaatdgirlgdrlrglwdlrlvggdaelpglpreglqlvldvapkgrgli
    gyldtperllaaepprfrvlgdllgassasirwrlvdqasgsvapthdcsavfdegdgtl
    sgriqrlersplspnedfrfvavkrhfplaherivlnekllgwlvspqhrlfhqlwhasr
    dkwhrlsekqrnalrgvgwqpgpldrerdargprkdrnasgidfffmhrhmlhtarsmqd
    lpswerlprpvvpleydrpgfiryfdnpdgfsvppawvavdddeysewlhglksaeayha
    nflvwesqyqdpaylakltlgqfgselelgmhdwlhmrwasvtrdpsngapvmtdrfpad
    faprwfrpendflgdpfsshvnpvfwsfhgwiddriedwyraherfhpgevqrrevegiq
    wfapgrwvevgdpwlgpathdvetmklalriifsrrpwyarnlklardq
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >6eysB (B:)
    hhhhhhssglevlfqgtthrhltreeepqtpdeasldlaatdgirlgdrlrglwdlrlvg
    gdaelpglpreglqlvldvapkgrgligyldtperllaaepprfrvlgdllgassasirw
    rlvdqasgsvapthdcsavfdevwadyanagdgtlsgriqrlersplspnedfrfvavkr
    hfplaherivlnekllgwlvspqhrlfhqlwhasrdkwhrlsekqrnalrgvgwqpgpld
    rerdargprkdrnasgidfffmhrhmlhtarsmqdlpswerlprpvvpleydrpgfiryf
    dnpdgfsvppawvavdddeysewlhglksaeayhanflvwesqyqdpaylakltlgqfgs
    elelgmhdwlhmrwasvtrdpsngapvmtdrfpadfaprwfrpendflgdpfsshvnpvf
    wsfhgwiddriedwyraherfhpgevqrrevegiqwfapgrwvevgdpwlgpathgcgls
    dvqassnsveldvetmklalriifseedqlsgwlkraprrpwyarnlklardqlrr
    

    Sequence, based on observed residues (ATOM records):
    >6eysB (B:)
    pqtpdeasldlaatdgirlgdrlrglwdlrlvggdaelpglpreglqlvldvapkgrgli
    gyldtperllaaepprfrvlgdllgassasirwrlvdqasgsvapthdcsavfdevwdgt
    lsgriqrlersplspnedfrfvavkrhfplaherivlnekllgwlvspqhrlfhqlwhas
    rdkwhrlsekqrnalrgvgwqpgpldrerdargprkdrnasgidfffmhrhmlhtarsmq
    dlpswerlprpvvpleydrpgfiryfdnpdgfsvppawvavdddeysewlhglksaeayh
    anflvwesqyqdpaylakltlgqfgselelgmhdwlhmrwasvtrdpsngapvmtdrfpa
    dfaprwfrpendflgdpfsshvnpvfwsfhgwiddriedwyraherfhpgevqrrevegi
    qwfapgrwvevgdpwlgpathgdvetmklalriifseedqlprrpwyarnlklardql
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >6eysC (C:)
    hhhhhhssglevlfqgtthrhltreeepqtpdeasldlaatdgirlgdrlrglwdlrlvg
    gdaelpglpreglqlvldvapkgrgligyldtperllaaepprfrvlgdllgassasirw
    rlvdqasgsvapthdcsavfdevwadyanagdgtlsgriqrlersplspnedfrfvavkr
    hfplaherivlnekllgwlvspqhrlfhqlwhasrdkwhrlsekqrnalrgvgwqpgpld
    rerdargprkdrnasgidfffmhrhmlhtarsmqdlpswerlprpvvpleydrpgfiryf
    dnpdgfsvppawvavdddeysewlhglksaeayhanflvwesqyqdpaylakltlgqfgs
    elelgmhdwlhmrwasvtrdpsngapvmtdrfpadfaprwfrpendflgdpfsshvnpvf
    wsfhgwiddriedwyraherfhpgevqrrevegiqwfapgrwvevgdpwlgpathgcgls
    dvqassnsveldvetmklalriifseedqlsgwlkraprrpwyarnlklardqlrr
    

    Sequence, based on observed residues (ATOM records):
    >6eysC (C:)
    pqtpdeasldlaatdgirlgdrlrglwdlrlvggdaelpglpreglqlvldvapkgrgli
    gyldtperllaaepprfrvlgdllgassasirwrlvdqasgsvapthdcsavfdevdgtl
    sgriqrlersplspnedfrfvavkrhfplaherivlnekllgwlvspqhrlfhqlwhasr
    dkwhrlsekqrnalrgvgwqpgpldrerdargprkdrnasgidfffmhrhmlhtarsmqd
    lpswerlprpvvpleydrpgfiryfdnpdgfsvppawvavdddeysewlhglksaeayha
    nflvwesqyqdpaylakltlgqfgselelgmhdwlhmrwasvtsngapvmtdrfpadfap
    rwfrpendflgdpfsshvnpvfwsfhgwiddriedwyraherfhpgevqrrevegiqwfa
    pgrwvevgdpwlgpathgcdvetmklalriifseprrpwyarnlklardq
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >6eysD (D:)
    hhhhhhssglevlfqgtthrhltreeepqtpdeasldlaatdgirlgdrlrglwdlrlvg
    gdaelpglpreglqlvldvapkgrgligyldtperllaaepprfrvlgdllgassasirw
    rlvdqasgsvapthdcsavfdevwadyanagdgtlsgriqrlersplspnedfrfvavkr
    hfplaherivlnekllgwlvspqhrlfhqlwhasrdkwhrlsekqrnalrgvgwqpgpld
    rerdargprkdrnasgidfffmhrhmlhtarsmqdlpswerlprpvvpleydrpgfiryf
    dnpdgfsvppawvavdddeysewlhglksaeayhanflvwesqyqdpaylakltlgqfgs
    elelgmhdwlhmrwasvtrdpsngapvmtdrfpadfaprwfrpendflgdpfsshvnpvf
    wsfhgwiddriedwyraherfhpgevqrrevegiqwfapgrwvevgdpwlgpathgcgls
    dvqassnsveldvetmklalriifseedqlsgwlkraprrpwyarnlklardqlrr
    

    Sequence, based on observed residues (ATOM records):
    >6eysD (D:)
    pqtpdeasldlaatdgirlgdrlrglwdlrlvggdaelpglpreglqlvldvapkgrgli
    gyldtperllaaepprfrvlgdllgassasirwrlvdqasgsvapthdcsavfdevdgtl
    sgriqrlersplspnedfrfvavkrhfplaherivlnekllgwlvspqhrlfhqlwhasr
    dkwhrlsekqrnalrgvgwqpgpldrerdargprkdrnasgidfffmhrhmlhtarsmqd
    lpswerlprpvvpleydrpgfiryfdnpdgfsvppawvavdddeysewlhglksaeayha
    nflvwesqyqdpaylakltlgqfgselelgmhdwlhmrwasvtrdpsngapvmtdrfpad
    faprwfrpendflgdpfsshvnpvfwsfhgwiddriedwyraherfhpgevqrrevegiq
    wfapgrwvevgdpwlgpathdvetmklalriifseedrrpwyarnlklardq