PDB entry 6eyq

View 6eyq on RCSB PDB site
Description: Crystal structure of a mutated OpuBC in complex with choline
Class: transport protein
Keywords: substrate binding protein, TRANSPORT PROTEIN
Deposited on 2017-11-13, released 2018-11-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-11-21, with a file datestamp of 2018-11-16.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Choline-binding protein
    Species: Bacillus subtilis (strain 168) [TaxId:224308]
    Gene: opuBC, proX, BSU33710
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q45462
      • engineered mutation (95)
    Domains in SCOPe 2.07: d6eyqa_
  • Chain 'B':
    Compound: Choline-binding protein
    Species: Bacillus subtilis (strain 168) [TaxId:224308]
    Gene: opuBC, proX, BSU33710
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q45462
      • engineered mutation (95)
    Domains in SCOPe 2.07: d6eyqb_
  • Heterogens: CHT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6eyqA (A:)
    mkrkylklmiglalaatltlsgcslpglsaaadqtikigaqsmseseiiasmlgqliehh
    tdlktttiknlgsnavqqqalmngeidiaatrytgtaltgtlrmepekdpdkalaltqre
    fkkrydlkwydsygfdntyaftvskeladqyhletvsdvkkwapqlklgvdnywmklkgn
    gyqdftktygmtfggtypmqiglvydavksgkmdivlaystdgriksyglkmlkddkqff
    ppydcspvvpekvlkehpelegiikkmlgkidtatmqelnyevdgnlkepsvvakeylek
    hryfes
    

    Sequence, based on observed residues (ATOM records): (download)
    >6eyqA (A:)
    tikigaqsmseseiiasmlgqliehhtdlktttiknlgsnavqqqalmngeidiaatryt
    gtaltgtlrmepekdpdkalaltqrefkkrydlkwydsygfdntyaftvskeladqyhle
    tvsdvkkwapqlklgvdnywmklkgngyqdftktygmtfggtypmqiglvydavksgkmd
    ivlaystdgriksyglkmlkddkqffppydcspvvpekvlkehpelegiikkmlgkidta
    tmqelnyevdgnlkepsvvakeylekhryfe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6eyqB (B:)
    mkrkylklmiglalaatltlsgcslpglsaaadqtikigaqsmseseiiasmlgqliehh
    tdlktttiknlgsnavqqqalmngeidiaatrytgtaltgtlrmepekdpdkalaltqre
    fkkrydlkwydsygfdntyaftvskeladqyhletvsdvkkwapqlklgvdnywmklkgn
    gyqdftktygmtfggtypmqiglvydavksgkmdivlaystdgriksyglkmlkddkqff
    ppydcspvvpekvlkehpelegiikkmlgkidtatmqelnyevdgnlkepsvvakeylek
    hryfes
    

    Sequence, based on observed residues (ATOM records): (download)
    >6eyqB (B:)
    tikigaqsmseseiiasmlgqliehhtdlktttiknlgsnavqqqalmngeidiaatryt
    gtaltgtlrmepekdpdkalaltqrefkkrydlkwydsygfdntyaftvskeladqyhle
    tvsdvkkwapqlklgvdnwmgyqdftktygmtfggtypmqiglvydavksgkmdivlays
    tdgriksyglkmlkddkqffppydcspvvpekvlkehpelegiikkmlgkidtatmqeln
    yevdgnlkepsvvakeylekhryfe