PDB entry 6eyn

View 6eyn on RCSB PDB site
Description: Structure of the 8D6 (anti-IgE) Fab
Class: immune system
Keywords: Immunoglobulin E, Fab, antibody, IMMUNE SYSTEM
Deposited on 2017-11-13, released 2018-08-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-15, with a file datestamp of 2018-08-10.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 8D6 Fab light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6EYN (0-End)
    Domains in SCOPe 2.07: d6eyna1, d6eyna2
  • Chain 'B':
    Compound: 8D6 Fab heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6EYN
  • Chain 'C':
    Compound: 8D6 Fab light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6EYN (0-End)
    Domains in SCOPe 2.07: d6eync1, d6eync2
  • Chain 'D':
    Compound: 8D6 Fab heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6EYN (0-End)
  • Chain 'H':
    Compound: 8D6 Fab heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6EYN
  • Chain 'L':
    Compound: 8D6 Fab light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6EYN (0-End)
    Domains in SCOPe 2.07: d6eynl1, d6eynl2
  • Heterogens: PEG, EDO, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6eynA (A:)
    divltqspaslavslgqratisckasqsvdydgdtymnwyhqkpgqppklliyaasnlds
    giparfsgsgsgtdftlnihpveeedaatyycqqtnedpwtfgggtkleikrtvaapsvf
    ifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysls
    stltlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >6eynA (A:)
    divltqspaslavslgqratisckasqsvdydtymnwyhqkpgqppklliyaasnldsgi
    parfsgsgsgtdftlnihpveeedaatyycqqtnedpwtfgggtkleikrtvaapsvfif
    ppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsst
    ltlskadyekhkvyacevthqglsspvtksfnrg
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6eynC (C:)
    divltqspaslavslgqratisckasqsvdydgdtymnwyhqkpgqppklliyaasnlds
    giparfsgsgsgtdftlnihpveeedaatyycqqtnedpwtfgggtkleikrtvaapsvf
    ifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysls
    stltlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >6eynC (C:)
    divltqspaslavslgqratisckasqsvdydgdtymnwyhqkpgqppklliyaasnlds
    giparfsgsgsgtdftlnihpveeedaatyycqqtnedpwtfgggtkleikrtvaapsvf
    ifppsdetasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltl
    skadyekhkvyacevthqglsspvtks
    

  • Chain 'D':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >6eynL (L:)
    divltqspaslavslgqratisckasqsvdydgdtymnwyhqkpgqppklliyaasnlds
    giparfsgsgsgtdftlnihpveeedaatyycqqtnedpwtfgggtkleikrtvaapsvf
    ifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysls
    stltlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >6eynL (L:)
    divltqspaslavslgqratisckasqsvdydgdtymnwyhqkpgqppklliyaasnlds
    giparfsgsgsgtdftlnihpveeedaatyycqqtnedpwtfgggtkleikrtvaapsvf
    ifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysls
    stltlskadyekhkvyacevthqglsspvtksfnrge