PDB entry 6eyi

View 6eyi on RCSB PDB site
Description: e-selectin lectin, egf-like and two scr domains complexed with glycomimetic ligand bw69669
Deposited on 2017-11-13, released 2018-11-21
The last revision was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 2.04 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: e-selectin
    Species: Homo sapiens [TaxId:9606]
    Gene: SELE, ELAM1
    Database cross-references and differences (RAF-indexed):
  • Heterogens: NAG, C4Z, CA, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6eyiA (A:)
wsyntsteamtydeasaycqqrythlvaiqnkeeieylnsilsyspsyywigirkvnnvw
vwvgtqkplteeaknwapgepnnrqkdedcveiyikrekdvgmwndercskkklalcyta
actntscsghgecvetinnytckcdpgfsglkceqivnctalespehgslvcshplgnfs
ynsscsiscdrgylpssmetmqcmssgewsapipacnvvecdavtnpangfvecfqnpgs
fpwnttctfdceegfelmgaqslqctssgnwdnekptcka