PDB entry 6eyh

View 6eyh on RCSB PDB site
Description: Structure of a OpuBC mutant with bound Glycine betaine
Class: transport protein
Keywords: substrate binding protein, ABC transporter, importer, TRANSPORT PROTEIN
Deposited on 2017-11-13, released 2018-11-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-11-21, with a file datestamp of 2018-11-16.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Choline binding protein OpuBC
    Species: BACILLUS SUBTILIS SUBSP. SUBTILIS STR. 168 [TaxId:224308]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q45462 (Start-305)
      • conflict (95)
    Domains in SCOPe 2.07: d6eyha_
  • Heterogens: DQY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6eyhA (A:)
    mkrkylklmiglalaatltlsgcslpglsaaadqtikigaqsmseseiiasmlgqliehh
    tdlktttiknlgsnavqqqalmngeidiaatrytgtaltgtlrmepekdpdkalaltqre
    fkkrydlkwydsygfdntyaftvskeladqyhletvsdvkkwapqlklgvdnywmklkgn
    gyqdftktygmtfggtypmqiglvydavksgkmdivlaystdgriksyglkmlkddkqff
    ppydcspvvpekvlkehpelegiikkmlgkidtatmqelnyevdgnlkepsvvakeylek
    hryfes
    

    Sequence, based on observed residues (ATOM records): (download)
    >6eyhA (A:)
    glsaaadqtikigaqsmseseiiasmlgqliehhtdlktttiknlgsnavqqqalmngei
    diaatrytgtaltgtlrmepekdpdkalaltqrefkkrydlkwydsygfdntyaftvske
    ladqyhletvsdvkkwapqlklgvdnywmklkgngyqdftktygmtfggtypmqiglvyd
    avksgkmdivlaystdgriksyglkmlkddkqffppydcspvvpekvlkehpelegiikk
    mlgkidtatmqelnyevdgnlkepsvvakeylekhryfes