PDB entry 6eyg

View 6eyg on RCSB PDB site
Description: Structure of a OpuBC mutant with bound Glycine betaine
Class: transport protein
Keywords: substrate binding protein, ABC transporter, importer, TRANSPORT PROTEIN
Deposited on 2017-11-13, released 2018-11-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-11-21, with a file datestamp of 2018-11-16.
Experiment type: XRAY
Resolution: 1.42 Å
R-factor: N/A
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Osmotically activated L-carnitine/choline ABC transporter substrate-binding protein OpuCC
    Species: Bacillus subtilis [TaxId:1423]
    Gene: B4417_3194
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6eyga_
  • Heterogens: BET, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6eygA (A:)
    mkrkylklmiglalaatltlsgcslpglsaaadqtikigaqsmseseiiasmlgqliehh
    tdlktttiknlgsnavqqqalmngeidiaatrytgtaltgtlrmepekdpdkalaltqre
    fkkrydlkwydsygfdntyaftvskeladqyhletvsdvkkwapqlklgvdnywmklkgn
    gyqdftktygmtfggtypmqiglvydavksgkmdivlaystdgriksyglkmlkddkqff
    ppydcspvvpekvlkehpelegiikkmlgkidtatmqelnyevdgnlkepsvvakeylek
    hryfes
    

    Sequence, based on observed residues (ATOM records): (download)
    >6eygA (A:)
    glsaaadqtikigaqsmseseiiasmlgqliehhtdlktttiknlgsnavqqqalmngei
    diaatrytgtaltgtlrmepekdpdkalaltqrefkkrydlkwydsygfdntyaftvske
    ladqyhletvsdvkkwapqlklgvdnywmklkgngyqdftktygmtfggtypmqiglvyd
    avksgkmdivlaystdgriksyglkmlkddkqffppydcspvvpekvlkehpelegiikk
    mlgkidtatmqelnyevdgnlkepsvvakeylekhryfes