PDB entry 6eyf

View 6eyf on RCSB PDB site
Description: Butyrylcolinesterase expressed in CHO cells co-crystallised with a rivastigmine analogue
Class: hydrolase
Keywords: Butyrylcholinesterase, alzheimer disease, organophosphate, carbamylated, rivastigmine analogue, rational design, HYDROLASE
Deposited on 2017-11-12, released 2018-11-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-11-21, with a file datestamp of 2018-11-16.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cholinesterase
    Species: Homo sapiens [TaxId:9606]
    Gene: BCHE, CHE1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6eyfa_
  • Heterogens: NAG, BY2, GOL, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6eyfA (A:)
    diiiatkngkvrgmnltvfggtvtaflgipyaqpplgrlrfkkpqsltkwsdiwnatkya
    nsccqnidqsfpgfhgsemwnpntdlsedclylnvwipapkpknatvliwiygggfqtgt
    sslhvydgkflarvervivvsmnyrvgalgflalpgnpeapgnmglfdqqlalqwvqkni
    aafggnpksvtlfgexagaasvslhllspgshslftrailqsgsfnapwavtslyearnr
    tlnlakltgcsreneteiikclrnkdpqeillneafvvpygtplsvnfgptvdgdfltdm
    pdillelgqfkktqilvgvnkdegtaflvygapgfskdnnsiitrkefqeglkiffpgvs
    efgkesilfhytdwvddqrpenyrealgdvvgdynficpaleftkkfsewgnnaffyyfe
    hrssklpwpewmgvmhgyeiefvfglplerrdnytkaeeilsrsivkrwanfakygnpne
    tqnnstswpvfksteqkyltlntestrimtklraqqcrfwtsffpkv