PDB entry 6ey2

View 6ey2 on RCSB PDB site
Description: Crystal structure of XIAP-BIR3 in complex with a cIAP1-selective SM
Class: signaling protein
Keywords: Zinc finger motif, smac-mimetic, protein-ligand complex, BIR domain, signaling protein
Deposited on 2017-11-10, released 2018-08-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-09-19, with a file datestamp of 2018-09-14.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: E3 ubiquitin-protein ligase XIAP
    Species: Homo sapiens [TaxId:9606]
    Gene: XIAP, API3, BIRC4, IAP3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6ey2a_
  • Chain 'B':
    Compound: E3 ubiquitin-protein ligase XIAP
    Species: Homo sapiens [TaxId:9606]
    Gene: XIAP, API3, BIRC4, IAP3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6ey2b_
  • Chain 'C':
    Compound: E3 ubiquitin-protein ligase XIAP
    Species: Homo sapiens [TaxId:9606]
    Gene: XIAP, API3, BIRC4, IAP3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6ey2c_
  • Chain 'D':
    Compound: E3 ubiquitin-protein ligase XIAP
    Species: Homo sapiens [TaxId:9606]
    Gene: XIAP, API3, BIRC4, IAP3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6ey2d_
  • Chain 'E':
    Compound: E3 ubiquitin-protein ligase XIAP
    Species: Homo sapiens [TaxId:9606]
    Gene: XIAP, API3, BIRC4, IAP3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6ey2e_
  • Chain 'F':
    Compound: E3 ubiquitin-protein ligase XIAP
    Species: Homo sapiens [TaxId:9606]
    Gene: XIAP, API3, BIRC4, IAP3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6ey2f_
  • Chain 'G':
    Compound: E3 ubiquitin-protein ligase XIAP
    Species: Homo sapiens [TaxId:9606]
    Gene: XIAP, API3, BIRC4, IAP3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6ey2g_
  • Chain 'H':
    Compound: E3 ubiquitin-protein ligase XIAP
    Species: Homo sapiens [TaxId:9606]
    Gene: XIAP, API3, BIRC4, IAP3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6ey2h_
  • Heterogens: ZN, C3T, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6ey2A (A:)
    hhhhhhssglvprgshmasmtggqqmgrgssdavssdrnfpnstnlprnpsmadyearif
    tfgtwiysvnkeqlaragfyalgegdkvkcfhcgggltdwkpsedpweqhakwypgckyl
    leqkgqeyinnihlthsleeclvrtt
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ey2A (A:)
    tnlprnpsmadyeariftfgtwiysvnkeqlaragfyalgegdkvkcfhcgggltdwkps
    edpweqhakwypgckylleqkgqeyinnihlthsleecl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6ey2B (B:)
    hhhhhhssglvprgshmasmtggqqmgrgssdavssdrnfpnstnlprnpsmadyearif
    tfgtwiysvnkeqlaragfyalgegdkvkcfhcgggltdwkpsedpweqhakwypgckyl
    leqkgqeyinnihlthsleeclvrtt
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ey2B (B:)
    tnlprnpsmadyeariftfgtwiysvnkeqlaragfyalgegdkvkcfhcgggltdwkps
    edpweqhakwypgckylleqkgqeyinnihlthsleec
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6ey2C (C:)
    hhhhhhssglvprgshmasmtggqqmgrgssdavssdrnfpnstnlprnpsmadyearif
    tfgtwiysvnkeqlaragfyalgegdkvkcfhcgggltdwkpsedpweqhakwypgckyl
    leqkgqeyinnihlthsleeclvrtt
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ey2C (C:)
    tnlprnpsmadyeariftfgtwiysvnkeqlaragfyalgegdkvkcfhcgggltdwkps
    edpweqhakwypgckylleqkgqeyinnihlthsleecl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6ey2D (D:)
    hhhhhhssglvprgshmasmtggqqmgrgssdavssdrnfpnstnlprnpsmadyearif
    tfgtwiysvnkeqlaragfyalgegdkvkcfhcgggltdwkpsedpweqhakwypgckyl
    leqkgqeyinnihlthsleeclvrtt
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ey2D (D:)
    tnlprnpsmadyeariftfgtwiysvnkeqlaragfyalgegdkvkcfhcgggltdwkps
    edpweqhakwypgckylleqkgqeyinnihlthsleeclvr
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6ey2E (E:)
    hhhhhhssglvprgshmasmtggqqmgrgssdavssdrnfpnstnlprnpsmadyearif
    tfgtwiysvnkeqlaragfyalgegdkvkcfhcgggltdwkpsedpweqhakwypgckyl
    leqkgqeyinnihlthsleeclvrtt
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ey2E (E:)
    stnlprnpsmadyeariftfgtwiysvnkeqlaragfyalgegdkvkcfhcgggltdwkp
    sedpweqhakwypgckylleqkgqeyinnihlthsleecl
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >6ey2F (F:)
    hhhhhhssglvprgshmasmtggqqmgrgssdavssdrnfpnstnlprnpsmadyearif
    tfgtwiysvnkeqlaragfyalgegdkvkcfhcgggltdwkpsedpweqhakwypgckyl
    leqkgqeyinnihlthsleeclvrtt
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ey2F (F:)
    tnlprnpsmadyeariftfgtwiysvnkeqlaragfyalgegdkvkcfhcgggltdwkps
    edpweqhakwypgckylleqkgqeyinnihlthsleeclvr
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >6ey2G (G:)
    hhhhhhssglvprgshmasmtggqqmgrgssdavssdrnfpnstnlprnpsmadyearif
    tfgtwiysvnkeqlaragfyalgegdkvkcfhcgggltdwkpsedpweqhakwypgckyl
    leqkgqeyinnihlthsleeclvrtt
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ey2G (G:)
    tnlprnpsmadyeariftfgtwiysvnkeqlaragfyalgegdkvkcfhcgggltdwkps
    edpweqhakwypgckylleqkgqeyinnihlthsleeclv
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >6ey2H (H:)
    hhhhhhssglvprgshmasmtggqqmgrgssdavssdrnfpnstnlprnpsmadyearif
    tfgtwiysvnkeqlaragfyalgegdkvkcfhcgggltdwkpsedpweqhakwypgckyl
    leqkgqeyinnihlthsleeclvrtt
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ey2H (H:)
    tnlprnpsmadyeariftfgtwiysvnkeqlaragfyalgegdkvkcfhcgggltdwkps
    edpweqhakwypgckylleqkgqeyinnihlthsleecl