PDB entry 6exx

View 6exx on RCSB PDB site
Description: crystal structure of pes4 rrm4
Deposited on 2017-11-10, released 2018-11-21
The last revision was dated 2018-11-21, with a file datestamp of 2018-11-16.
Experiment type: XRAY
Resolution: 1.1 Å
R-factor: N/A
AEROSPACI score: 0.73 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein PES4
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: PES4, YFR023W
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6exxA (A:)
kistlflenlsavcnkeflkylchqenirpfkiqidgydensstysgfikfrnfedatri
fnflnnrlvggsivttswe