PDB entry 6exw

View 6exw on RCSB PDB site
Description: Crystal structure of cIAP1-BIR3 in complex with a covalently bound SM
Class: signaling protein
Keywords: Zinc finger motif, smac-mimetic, protein-ligand complex, BIR domain, signaling protein
Deposited on 2017-11-10, released 2018-08-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-08, with a file datestamp of 2018-08-03.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Baculoviral IAP repeat-containing protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: BIRC2, API1, MIHB, RNF48
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6exwa_
  • Chain 'C':
    Compound: Baculoviral IAP repeat-containing protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: BIRC2, API1, MIHB, RNF48
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6exwc_
  • Heterogens: ZN, C3K, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6exwA (A:)
    mensletlrfsisnlsmqthaarmrtfmywpssvpvqpeqlasagfyyvgrnddvkcfcc
    dgglrcwesgddpwvehakwfprceflirmkgqefvdeiqgryphlleqllstslehhhh
    hh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6exwA (A:)
    sisnlsmqthaarmrtfmywpssvpvqpeqlasagfyyvgrnddvkcfccdgglrcwesg
    ddpwvehakwfprceflirmkgqefvdeiqgryphlle
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6exwC (C:)
    mensletlrfsisnlsmqthaarmrtfmywpssvpvqpeqlasagfyyvgrnddvkcfcc
    dgglrcwesgddpwvehakwfprceflirmkgqefvdeiqgryphlleqllstslehhhh
    hh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6exwC (C:)
    fsisnlsmqthaarmrtfmywpssvpvqpeqlasagfyyvgrnddvkcfccdgglrcwes
    gddpwvehakwfprceflirmkgqefvdeiqgryphl