PDB entry 6ext

View 6ext on RCSB PDB site
Description: crystal structure of the dna binding domain of fission yeast sap1
Deposited on 2017-11-09, released 2018-11-28
The last revision was dated 2018-11-28, with a file datestamp of 2018-11-23.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Switch-activating protein 1
    Species: Schizosaccharomyces pombe (strain 972 / ATCC 24843) [TaxId:284812]
    Gene: sap1, SPCC1672.02c
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6extA (A:)
    lspssspakaqrthlsleekiklmrlvvrhkhelvdrktsefyakiarigyedeglaiht
    esacrnqiisimrvyeqrlahrqpgmkttpeedeldqlcdewkarlselqqyrekf
    

    Sequence, based on observed residues (ATOM records):
    >6extA (A:)
    rthlsleekiklmrlvvrhkhelvdrktsefyakiarigyedeglaihtesacrnqiisi
    mrvyeqrlahrqpgmkttpeedeldqlcdewkarlselqqyrekf