PDB entry 6exs

View 6exs on RCSB PDB site
Description: Crystal structure of a POT family transporter in complex with thioalcohol conjugated peptide.
Class: membrane protein
Keywords: Major Facilitator Superfamily, POT transporter, conjugated peptide ligand, MEMBRANE PROTEIN
Deposited on 2017-11-09, released 2018-06-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-06-27, with a file datestamp of 2018-06-22.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peptide ABC transporter permease
    Species: Staphylococcus hominis [TaxId:1290]
    Gene: BL313_09825
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A1L8Y4Q3 (0-486)
      • conflict (209)
      • conflict (249)
      • conflict (279)
    Domains in SCOPe 2.07: d6exsa_
  • Heterogens: OLC, C3H, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6exsA (A:)
    qtiqsipqkgffghprglgvlffvefwerfsyygmramlifymyfaihqnglgidkttam
    simsvygaliymssipgawiadritgtrgatllgavliiighiclslpfalfglfssmff
    iiigsglmkpnisnivgrlypendtridagfvifymsvnlgalispiilqhfvdirnfhg
    gfllaaigmalglvwyllfnrknlgsvgmaptnplskeekrkygmiigiivaivivvllv
    tyythtlsfdlisntvlvlgvalpiiyfttmlrskdvtdgersrvkafiplfilgmlfws
    iqeqgsnvlniyglersdmqlnlfgwttrfgealfqsinplfillfapvismiwlkmgkk
    qpslaikfsigtllaglsyiliglvglgyghtqfsvnwvilsyvicvigelclsptgnsa
    avklapkafnaqmmsvwlltnasaqaingtlvklikplgqtnyfiflgtvaivitliilv
    fspkitk