PDB entry 6exo

View 6exo on RCSB PDB site
Description: Crystal Structure of Rhodesain in complex with a Macrolactam Inhibitor
Class: hydrolase
Keywords: Cysteine Protease, Papain-like Protease, Cathepsin L-like Protease, Endopeptidase, Hydrolase
Deposited on 2017-11-08, released 2018-04-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-04-11, with a file datestamp of 2018-04-06.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cysteine protease
    Species: Trypanosoma brucei rhodesiense [TaxId:31286]
    Gene: rhodesain
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q95PM0 (0-214)
      • engineered mutation (171)
    Domains in SCOPe 2.07: d6exoa_
  • Chain 'B':
    Compound: Cysteine protease
    Species: Trypanosoma brucei rhodesiense [TaxId:31286]
    Gene: rhodesain
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q95PM0 (0-214)
      • engineered mutation (171)
    Domains in SCOPe 2.07: d6exob_
  • Heterogens: EDO, C3E, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6exoA (A:)
    apaavdwrekgavtpvkdqgqcgscwafstigniegqwqvagnplvslseqmlvscdtid
    fgcggglmdnafnwivnsnggnvfteasypyvsgngeqpqcqmngheigaaitdhvdlpq
    dedaiaaylaengplaiavdatsfmdynggiltsctseqldhgvllvgyndasnppywii
    knswsnmwgedgyiriekgtnqclmnqavssavvg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6exoB (B:)
    apaavdwrekgavtpvkdqgqcgscwafstigniegqwqvagnplvslseqmlvscdtid
    fgcggglmdnafnwivnsnggnvfteasypyvsgngeqpqcqmngheigaaitdhvdlpq
    dedaiaaylaengplaiavdatsfmdynggiltsctseqldhgvllvgyndasnppywii
    knswsnmwgedgyiriekgtnqclmnqavssavvg