PDB entry 6exj

View 6exj on RCSB PDB site
Description: pdz domain from rat shank3 bound to the c terminus of somatostatin receptor subtype 2
Deposited on 2017-11-08, released 2018-03-07
The last revision was dated 2018-07-11, with a file datestamp of 2018-07-06.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: SH3 and multiple ankyrin repeat domains protein 3
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Shank3, Prosap2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9JLU4 (1-95)
      • expression tag (0)
  • Chain 'B':
    Compound: sstr2
    Species: Rattus norvegicus, synthetic [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • PDB 6EXJ (Start-5)
  • Chain 'C':
    Compound: SH3 and multiple ankyrin repeat domains protein 3
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Shank3, Prosap2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9JLU4 (1-95)
      • expression tag (0)
  • Chain 'D':
    Compound: sstr2
    Species: Rattus norvegicus, synthetic [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • PDB 6EXJ (Start-5)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6exjA (A:)
svailqkrdhegfgfvlrgakaetpieeftptpafpalqylesvdvegvawkaglrtgdf
lievngvnvvkvghkqvvglirqggnrlvmkvvsvt

    Sequence, based on observed residues (ATOM records):
    >6exjA (A:)
svailqkrdhegfgfvlrgakaeptpafpalqylesvdvegvawkaglrtgdflievngv
nvvkvghkqvvglirqggnrlvmkvvsvt

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >6exjB (B:)
dlqtsi

  • Chain 'C':
    Sequence, based on SEQRES records:
    >6exjC (C:)
svailqkrdhegfgfvlrgakaetpieeftptpafpalqylesvdvegvawkaglrtgdf
lievngvnvvkvghkqvvglirqggnrlvmkvvsvt

    Sequence, based on observed residues (ATOM records):
    >6exjC (C:)
svailqkrdhegfgfvlrgakaettpafpalqylesvdvegvawkaglrtgdflievngv
nvvkvghkqvvglirqggnrlvmkvvsvt

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records:
    >6exjD (D:)
dlqtsi