PDB entry 6ex9

View 6ex9 on RCSB PDB site
Description: Crystal Structure of HIV-1 Integrase Catalytic Core Domain with Inhibitor Peptide
Class: viral protein
Keywords: HIV-1, Integrase, Retroviruses, Catalytic core, VIRAL PROTEIN
Deposited on 2017-11-07, released 2018-06-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-08-21, with a file datestamp of 2019-08-16.
Experiment type: XRAY
Resolution: 2.01 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: integrase
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0U5B5J2 (0-151)
      • conflict (74)
      • conflict (128)
    Domains in SCOPe 2.08: d6ex9a_
  • Chain 'B':
    Compound: Inhibitor peptide
    Species: synthetic construct, synthetic [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 6EX9 (0-14)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6ex9A (A:)
    spgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktihtd
    ngsnftgatvraacdwagikqefgipynpqsqgvvesmnkelkkiigqvrdqaehlktav
    qmavfihnkkrkggiggysagerivdiiatdi
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ex9A (A:)
    spgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktihtd
    ngsnftgatvraacdwagikqefqgvvesmnkelkkiigqvrdqaehlktavqmavfihn
    kkrkgysagerivdiiatdi
    

  • Chain 'B':
    No sequence available.