PDB entry 6ex5

View 6ex5 on RCSB PDB site
Description: Staphylococcus aureus triple mutant of superoxide dismutase SodM
Class: oxidoreductase
Keywords: superoxide dismutase, cambialistic, Staphylococcus aureus, oxidoreductase, metalloenzyme
Deposited on 2017-11-07, released 2018-11-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-06-10, with a file datestamp of 2020-06-05.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: superoxide dismutase
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: sodA, sodM, BER48_000119, BN1321_40056, CEJ93_07215, ERS072738_00830, ERS072840_00559, ERS073583_02338, ERS074020_00889, HMPREF3211_00238
    Database cross-references and differences (RAF-indexed):
    • Uniprot W8UU58 (0-197)
      • engineered mutation (17)
      • engineered mutation (157-158)
    Domains in SCOPe 2.08: d6ex5a1, d6ex5a2
  • Chain 'B':
    Compound: superoxide dismutase
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: sodA, sodM, BER48_000119, BN1321_40056, CEJ93_07215, ERS072738_00830, ERS072840_00559, ERS073583_02338, ERS074020_00889, HMPREF3211_00238
    Database cross-references and differences (RAF-indexed):
    • Uniprot W8UU58 (0-197)
      • engineered mutation (17)
      • engineered mutation (157-158)
    Domains in SCOPe 2.08: d6ex5b1, d6ex5b2
  • Heterogens: MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6ex5A (A:)
afklpnlpyaydalepyfdqrtmefhhdkhhntyvtklnatvegtelehqsladmianld
kvpeamrmsvrnnggghfnhslfweilspnseekggviddikaqwgtldefknefankat
tlfgsgwtwlvvndgkleivttpnqdnpltegktpilgldvwehayylkyqnkrpdymta
fwnivnwkkvdelyqaak

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6ex5B (B:)
afklpnlpyaydalepyfdqrtmefhhdkhhntyvtklnatvegtelehqsladmianld
kvpeamrmsvrnnggghfnhslfweilspnseekggviddikaqwgtldefknefankat
tlfgsgwtwlvvndgkleivttpnqdnpltegktpilgldvwehayylkyqnkrpdymta
fwnivnwkkvdelyqaak