PDB entry 6ewu

View 6ewu on RCSB PDB site
Description: solution structure of rhabdopeptide nrps docking domain kj12c-ndd
Deposited on 2017-11-06, released 2018-10-31
The last revision was dated 2021-06-23, with a file datestamp of 2021-06-18.
Experiment type: SOLID-STATENMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NRPS Kj12C-NDD
    Species: Xenorhabdus stockiae [TaxId:351614]
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6ewuA (A:)
    gidaaqivdealeqgitlfvvnnrlqyetsrdsiptellnkwkqhkqelidflnqldsee
    qtk