PDB entry 6ews

View 6ews on RCSB PDB site
Description: solution structure of rhabdopeptide nrps docking domain kj12a-ndd
Deposited on 2017-11-06, released 2018-10-31
The last revision was dated 2021-06-23, with a file datestamp of 2021-06-18.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NRPS Kj12A-NDD
    Species: Xenorhabdus stockiae [TaxId:351614]
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6ewsA (A:)
    mknaaqivdealnqgitlfvadnrlqyetsrdnipeellnewkyyrqdlidflqqldake
    etq