PDB entry 6ewr

View 6ewr on RCSB PDB site
Description: Putative sugar aminotransferase Spr1654 from Streptococcus pneumoniae, PMP-form
Class: sugar binding protein
Keywords: teichoic acid, pneumococcus, sugar aminotransferase, PMP, SUGAR BINDING PROTEIN
Deposited on 2017-11-06, released 2018-05-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-02, with a file datestamp of 2018-04-27.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative capsular polysaccharide biosynthesis protein
    Species: Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) [TaxId:170187]
    Gene: SP_1837
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ewra_
  • Chain 'B':
    Compound: putative capsular polysaccharide biosynthesis protein
    Species: Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) [TaxId:170187]
    Gene: SP_1837
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: putative capsular polysaccharide biosynthesis protein
    Species: Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) [TaxId:170187]
    Gene: SP_1837
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ewrc_
  • Chain 'D':
    Compound: putative capsular polysaccharide biosynthesis protein
    Species: Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) [TaxId:170187]
    Gene: SP_1837
    Database cross-references and differences (RAF-indexed):
  • Heterogens: PMP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6ewrA (A:)
    masmtgmpnynipfsppditeaeitevvdtlrsgwittgpktkelerrlslytqtpktvc
    lnsataalelilrvlevgpgdevivpamtytascsvithvgatpvmvdiqadtfemdydl
    leqaitektkviipvelagivcdydrlfqvvekkrdfftasskwqkafnrivivsdsaha
    lgstykgqpsgsiadftsfsfhavknfttaeggsatwkanpviddeemykefqilslhgq
    tkdalakmqlgsweydivtpaykcnmtdimaslglvqldrypsllqrrkdivdrydsgfa
    gsrihplahktetvessrhlyitrvegasleernliiqelakagiasnvhykplplltay
    knlgfdmtnypkayaffeneitlplhtklsdeevdyiietfktvsekvltlskkklaaal
    ehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ewrA (A:)
    nipfsppditeaeitevvdtlrsgwittgpktkelerrlslytqtpktvclnsataalel
    ilrvlevgpgdevivpamtytascsvithvgatpvmvdiqadtfemdydlleqaitektk
    viipvelagivcdydrlfqvvekkrdfftasskwqkafnrivivsdsahalgstykgqps
    gsiadftsfsfhavknfttaeggsatwkanpviddeemykefqilslhgqtkdalakmql
    gsweydivtpaykcnmtdimaslglvqldrypsllqrrkdivdrydsgfagsrihplahk
    tetvessrhlyitrvegasleernliiqelakagiasnvhykplplltayknlgfdmtny
    pkayaffeneitlplhtklsdeevdyiietfktvsekvl
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6ewrC (C:)
    masmtgmpnynipfsppditeaeitevvdtlrsgwittgpktkelerrlslytqtpktvc
    lnsataalelilrvlevgpgdevivpamtytascsvithvgatpvmvdiqadtfemdydl
    leqaitektkviipvelagivcdydrlfqvvekkrdfftasskwqkafnrivivsdsaha
    lgstykgqpsgsiadftsfsfhavknfttaeggsatwkanpviddeemykefqilslhgq
    tkdalakmqlgsweydivtpaykcnmtdimaslglvqldrypsllqrrkdivdrydsgfa
    gsrihplahktetvessrhlyitrvegasleernliiqelakagiasnvhykplplltay
    knlgfdmtnypkayaffeneitlplhtklsdeevdyiietfktvsekvltlskkklaaal
    ehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ewrC (C:)
    nipfsppditeaeitevvdtlrsgwittgpktkelerrlslytqtpktvclnsataalel
    ilrvlevgpgdevivpamtytascsvithvgatpvmvdiqadtfemdydlleqaitektk
    viipvelagivcdydrlfqvvekkrdfftasskwqkafnrivivsdsahalgstykgqps
    gsiadftsfsfhavknfttaeggsatwkanpviddeemykefqilslhgqtkdalakmql
    gsweydivtpaykcnmtdimaslglvqldrypsllqrrkdivdrydsgfagsrihplahk
    tetvessrhlyitrvegasleernliiqelakagiasnvhykplplltayknlgfdmtny
    pkayaffeneitlplhtklsdeevdyiietfktvsekvlt
    

  • Chain 'D':
    No sequence available.