PDB entry 6ewn

View 6ewn on RCSB PDB site
Description: hspa from thermosynechococcus vulcanus in the presence of 2m urea with initial stages of denaturation
Deposited on 2017-11-06, released 2018-10-17
The last revision was dated 2019-04-24, with a file datestamp of 2019-04-19.
Experiment type: XRAY
Resolution: 2.29 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: HspA
    Species: Thermosynechococcus vulcanus [TaxId:32053]
    Gene: hspA
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: HspA
    Species: Thermosynechococcus vulcanus [TaxId:32053]
    Gene: hspA
    Database cross-references and differences (RAF-indexed):
  • Heterogens: URE, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6ewnA (A:)
sflpaaeleetpealllkvelpgmdpkdidvqvtaeavsisgerksetktetegmkrtef
rygkfqrviplpvriqntsvkaeykdgilhltlpkaeee

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >6ewnB (B:)
sflpaaeleetpealllkvelpgmdpkdidvqvtaeavsisgerksetktetegmkrtef
rygkfqrviplpvriqntsvkaeykdgilhltlpkaeee