PDB entry 6ew7

View 6ew7 on RCSB PDB site
Description: Crystal structure of the BCL6 BTB domain in complex with anilinopyrimidine ligand
Class: transferase
Keywords: kinase, transferase
Deposited on 2017-11-03, released 2018-10-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-11-28, with a file datestamp of 2018-11-23.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: B-cell lymphoma 6 protein
  Species: Homo sapiens [TaxId:9606]
  Gene: BCL6, BCL5, LAZ3, ZBTB27, ZNF51
  Database cross-references and differences (RAF-indexed):
  • Uniprot P41182 (0-121)
    • conflict (1)
    • conflict (60)
    • conflict (77)
  Domains in SCOPe 2.08: d6ew7a_
• Chain 'B':
  Compound: B-cell lymphoma 6 protein
  Species: Homo sapiens [TaxId:9606]
  Gene: BCL6, BCL5, LAZ3, ZBTB27, ZNF51
  Database cross-references and differences (RAF-indexed):
  • Uniprot P41182 (0-121)
    • conflict (1)
    • conflict (60)
    • conflict (77)
  Domains in SCOPe 2.08: d6ew7b_
• Heterogens: CL, C1W, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6ew7A (A:)
  sqiqftrhasdvllnlnrlrsrdiltdvvivvsreqfrahktvlmacsglfysiftdqlk
  rnlsvinldpeinpegfnilldfmytsrlnlregnimavmatamylqmehvvdtcrkfik
  as
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6ew7B (B:)
  sqiqftrhasdvllnlnrlrsrdiltdvvivvsreqfrahktvlmacsglfysiftdqlk
  rnlsvinldpeinpegfnilldfmytsrlnlregnimavmatamylqmehvvdtcrkfik
  as