PDB entry 6ew6

View 6ew6 on RCSB PDB site
Description: Crystal structure of the BCL6 BTB domain in complex with anilinopyrimidine ligand
Class: transferase
Keywords: kinase, transferase
Deposited on 2017-11-03, released 2018-10-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-11-28, with a file datestamp of 2018-11-23.
Experiment type: XRAY
Resolution: 1.39 Å
R-factor: N/A
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: B-cell lymphoma 6 protein
    Species: Homo sapiens [TaxId:9606]
    Gene: BCL6, BCL5, LAZ3, ZBTB27, ZNF51
    Database cross-references and differences (RAF-indexed):
    • Uniprot P41182 (0-122)
      • conflict (2)
      • conflict (61)
      • conflict (78)
      • conflict (115)
    Domains in SCOPe 2.08: d6ew6a_
  • Heterogens: C0H, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6ew6A (A:)
dsqiqftrhasdvllnlnrlrsrdiltdvvivvsreqfrahktvlmacsglfysiftdql
krnlsvinldpeinpegfnilldfmytsrlnlregnimavmatamylqmehvvdtarkfi
kas